Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E3I8N0

Protein Details
Accession A0A1E3I8N0    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
65-86GPQLLRKNSRSRKGKEKEDGDFBasic
NLS Segment(s)
PositionSequence
74-78RSRKG
Subcellular Location(s) nucl 19, cyto_nucl 15, cyto 7
Family & Domain DBs
Amino Acid Sequences MMYEVSDGDSVPSQSQSSADCSPSQTAQLLACKEASPGAPSSDALQNSSAPNISSPSGSGDISGGPQLLRKNSRSRKGKEKEDGDFEG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.13
3 0.13
4 0.16
5 0.17
6 0.18
7 0.18
8 0.2
9 0.21
10 0.21
11 0.21
12 0.16
13 0.15
14 0.15
15 0.18
16 0.17
17 0.16
18 0.16
19 0.14
20 0.14
21 0.14
22 0.12
23 0.1
24 0.1
25 0.1
26 0.1
27 0.1
28 0.12
29 0.14
30 0.14
31 0.13
32 0.13
33 0.13
34 0.13
35 0.13
36 0.11
37 0.08
38 0.08
39 0.09
40 0.09
41 0.08
42 0.08
43 0.1
44 0.12
45 0.11
46 0.11
47 0.1
48 0.09
49 0.1
50 0.1
51 0.07
52 0.06
53 0.09
54 0.11
55 0.17
56 0.22
57 0.26
58 0.36
59 0.46
60 0.56
61 0.63
62 0.67
63 0.72
64 0.77
65 0.83
66 0.82
67 0.8
68 0.78