Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E3HQA8

Protein Details
Accession A0A1E3HQA8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
16-41MAGSKAGKKKKWSKGKVKDKANNAVIHydrophilic
NLS Segment(s)
PositionSequence
14-35AAMAGSKAGKKKKWSKGKVKDK
Subcellular Location(s) mito 11, cyto 9, mito_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MPPQVKTKAQKAAAAMAGSKAGKKKKWSKGKVKDKANNAVILDKAVFDRIVKEVPTYKLISQSVLIDRMKINGSLARRAIAYLEKEGLIKRVVHHNAQLIYTRAIAGKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.33
3 0.24
4 0.24
5 0.21
6 0.21
7 0.22
8 0.25
9 0.29
10 0.39
11 0.48
12 0.56
13 0.66
14 0.74
15 0.79
16 0.84
17 0.9
18 0.9
19 0.91
20 0.87
21 0.83
22 0.82
23 0.73
24 0.65
25 0.54
26 0.47
27 0.36
28 0.29
29 0.22
30 0.14
31 0.11
32 0.09
33 0.08
34 0.06
35 0.07
36 0.08
37 0.09
38 0.09
39 0.1
40 0.13
41 0.14
42 0.17
43 0.17
44 0.16
45 0.2
46 0.2
47 0.19
48 0.17
49 0.17
50 0.16
51 0.19
52 0.18
53 0.15
54 0.15
55 0.16
56 0.16
57 0.14
58 0.14
59 0.13
60 0.15
61 0.18
62 0.18
63 0.17
64 0.17
65 0.17
66 0.17
67 0.18
68 0.18
69 0.16
70 0.17
71 0.16
72 0.18
73 0.18
74 0.19
75 0.17
76 0.16
77 0.16
78 0.25
79 0.28
80 0.3
81 0.33
82 0.37
83 0.36
84 0.37
85 0.38
86 0.31
87 0.29
88 0.26
89 0.23