Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E3HKZ6

Protein Details
Accession A0A1E3HKZ6    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
91-115EEIEKSKEPKKAKKGQSKLPMPLVYHydrophilic
NLS Segment(s)
PositionSequence
97-105KEPKKAKKG
Subcellular Location(s) nucl 23.5, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MSARPLKSALKKPTKSFETPAAGPSKPSFSANKPSQGKSKVKATVSIAKKPEKLRGPDLASDSESNASGFEDESGDEGEVVDEDEEMNTDEEIEKSKEPKKAKKGQSKLPMPLVYL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.7
3 0.64
4 0.62
5 0.58
6 0.52
7 0.51
8 0.46
9 0.39
10 0.36
11 0.34
12 0.29
13 0.24
14 0.26
15 0.25
16 0.25
17 0.35
18 0.37
19 0.45
20 0.45
21 0.47
22 0.51
23 0.55
24 0.56
25 0.5
26 0.54
27 0.5
28 0.47
29 0.48
30 0.45
31 0.46
32 0.45
33 0.48
34 0.44
35 0.42
36 0.46
37 0.44
38 0.47
39 0.44
40 0.44
41 0.41
42 0.43
43 0.42
44 0.4
45 0.4
46 0.33
47 0.29
48 0.25
49 0.21
50 0.15
51 0.13
52 0.1
53 0.08
54 0.07
55 0.06
56 0.05
57 0.05
58 0.05
59 0.05
60 0.06
61 0.06
62 0.06
63 0.05
64 0.05
65 0.05
66 0.05
67 0.05
68 0.04
69 0.04
70 0.04
71 0.04
72 0.04
73 0.05
74 0.06
75 0.05
76 0.06
77 0.07
78 0.07
79 0.1
80 0.13
81 0.14
82 0.18
83 0.24
84 0.31
85 0.39
86 0.48
87 0.56
88 0.64
89 0.72
90 0.78
91 0.82
92 0.85
93 0.87
94 0.86
95 0.83
96 0.81