Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3I0Y7

Protein Details
Accession A0A1E3I0Y7    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MAKTPSGHRRPTRRSHRRDTFVHPPBasic
NLS Segment(s)
PositionSequence
120-131ARKKKQKAGKKV
Subcellular Location(s) plas 13, mito 9, E.R. 2, cyto 1, extr 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR009914  DPM2  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0030234  F:enzyme regulator activity  
GO:0019348  P:dolichol metabolic process  
GO:0006486  P:protein glycosylation  
Pfam View protein in Pfam  
PF07297  DPM2  
Amino Acid Sequences MAKTPSGHRRPTRRSHRRDTFVHPPLLFLSSVLLPHPKHPRSLIMAQSDKLLGGAMLLVAAFVFVYYTTWALFTPFLPSDSPLQSLFPARDWAIRLPLFVLLTGISVIGLFFGKVLLGEARKKKQKAGKKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.88
3 0.89
4 0.86
5 0.83
6 0.8
7 0.8
8 0.76
9 0.73
10 0.62
11 0.52
12 0.46
13 0.42
14 0.33
15 0.22
16 0.17
17 0.11
18 0.12
19 0.11
20 0.14
21 0.13
22 0.2
23 0.29
24 0.28
25 0.31
26 0.32
27 0.35
28 0.37
29 0.42
30 0.41
31 0.39
32 0.39
33 0.37
34 0.36
35 0.32
36 0.25
37 0.2
38 0.14
39 0.06
40 0.04
41 0.04
42 0.03
43 0.02
44 0.02
45 0.02
46 0.02
47 0.02
48 0.02
49 0.02
50 0.02
51 0.02
52 0.02
53 0.03
54 0.04
55 0.04
56 0.04
57 0.04
58 0.05
59 0.06
60 0.06
61 0.09
62 0.09
63 0.1
64 0.1
65 0.12
66 0.14
67 0.15
68 0.17
69 0.13
70 0.14
71 0.14
72 0.15
73 0.15
74 0.13
75 0.14
76 0.13
77 0.15
78 0.17
79 0.17
80 0.21
81 0.21
82 0.2
83 0.18
84 0.19
85 0.17
86 0.15
87 0.14
88 0.07
89 0.08
90 0.07
91 0.06
92 0.04
93 0.04
94 0.04
95 0.04
96 0.04
97 0.04
98 0.04
99 0.04
100 0.04
101 0.04
102 0.06
103 0.09
104 0.12
105 0.21
106 0.29
107 0.39
108 0.48
109 0.5
110 0.58
111 0.64