Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3HDQ1

Protein Details
Accession A0A1E3HDQ1    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
4-29RLYTKGRIIGHKRGKRNSRPNQSLVQHydrophilic
NLS Segment(s)
PositionSequence
14-19HKRGKR
Subcellular Location(s) mito 23.5, mito_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038661  L35A_sf  
IPR001780  Ribosomal_L35A  
IPR009000  Transl_B-barrel_sf  
Gene Ontology GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01247  Ribosomal_L35Ae  
Amino Acid Sequences MASRLYTKGRIIGHKRGKRNSRPNQSLVQVEGVDSAEAARAYLGKRVAYVYKAKREINGSKVRVIWGRISRSHGGNGVVKTKFRTNLPAKTFGASCRIMLFPSNI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.72
3 0.76
4 0.81
5 0.82
6 0.86
7 0.86
8 0.87
9 0.85
10 0.81
11 0.76
12 0.7
13 0.61
14 0.52
15 0.43
16 0.32
17 0.25
18 0.21
19 0.15
20 0.11
21 0.09
22 0.07
23 0.06
24 0.05
25 0.05
26 0.04
27 0.05
28 0.06
29 0.09
30 0.1
31 0.09
32 0.1
33 0.12
34 0.13
35 0.14
36 0.22
37 0.24
38 0.29
39 0.33
40 0.33
41 0.34
42 0.39
43 0.4
44 0.4
45 0.44
46 0.39
47 0.37
48 0.37
49 0.37
50 0.33
51 0.31
52 0.29
53 0.27
54 0.29
55 0.29
56 0.34
57 0.35
58 0.34
59 0.34
60 0.3
61 0.27
62 0.28
63 0.27
64 0.28
65 0.27
66 0.26
67 0.28
68 0.31
69 0.31
70 0.28
71 0.36
72 0.37
73 0.46
74 0.5
75 0.54
76 0.5
77 0.5
78 0.49
79 0.41
80 0.4
81 0.32
82 0.27
83 0.23
84 0.22
85 0.2