Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3HWC5

Protein Details
Accession A0A1E3HWC5   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
45-64MWYRRESARKRETRHKPAARBasic
NLS Segment(s)
PositionSequence
53-62RKRETRHKPA
Subcellular Location(s) plas 7E.R. 7, mito 5, cyto 3, mito_nucl 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MGSRQDVTGQITLEGSLLTERIVFCSLLALTLFLLLVGFITITVMWYRRESARKRETRHKPAARWGPWSEEENRFVKRSRTSSLIFEKDHVSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.08
3 0.06
4 0.06
5 0.05
6 0.06
7 0.06
8 0.08
9 0.1
10 0.09
11 0.09
12 0.11
13 0.1
14 0.09
15 0.09
16 0.08
17 0.06
18 0.06
19 0.06
20 0.04
21 0.04
22 0.03
23 0.03
24 0.02
25 0.02
26 0.02
27 0.02
28 0.02
29 0.03
30 0.04
31 0.05
32 0.06
33 0.07
34 0.09
35 0.13
36 0.2
37 0.24
38 0.34
39 0.43
40 0.5
41 0.55
42 0.65
43 0.71
44 0.74
45 0.8
46 0.78
47 0.72
48 0.74
49 0.78
50 0.71
51 0.67
52 0.58
53 0.53
54 0.48
55 0.48
56 0.43
57 0.38
58 0.39
59 0.36
60 0.38
61 0.34
62 0.34
63 0.37
64 0.39
65 0.39
66 0.4
67 0.42
68 0.41
69 0.47
70 0.54
71 0.55
72 0.48
73 0.46