Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3I6M6

Protein Details
Accession A0A1E3I6M6   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
95-118TTETPKGRSKFRNWWKPEPKVVTHHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 14, mito 8, cyto 3
Family & Domain DBs
Amino Acid Sequences MGQAAGLLALVSALACASRSPEGARPECWCTRQVLGATLLVPKSTGQTPDLVHLCHHEECIVDPIRLHDTYARGACRAAISGKRRYLPSQPHPPTTETPKGRSKFRNWWKPEPKVVTHRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.03
3 0.04
4 0.07
5 0.08
6 0.1
7 0.13
8 0.19
9 0.26
10 0.29
11 0.31
12 0.32
13 0.37
14 0.4
15 0.39
16 0.34
17 0.3
18 0.29
19 0.31
20 0.28
21 0.24
22 0.22
23 0.2
24 0.2
25 0.18
26 0.17
27 0.12
28 0.12
29 0.09
30 0.1
31 0.1
32 0.11
33 0.1
34 0.13
35 0.13
36 0.17
37 0.18
38 0.17
39 0.15
40 0.16
41 0.18
42 0.16
43 0.15
44 0.11
45 0.1
46 0.1
47 0.15
48 0.14
49 0.11
50 0.11
51 0.12
52 0.15
53 0.15
54 0.15
55 0.12
56 0.13
57 0.16
58 0.19
59 0.18
60 0.15
61 0.15
62 0.16
63 0.14
64 0.14
65 0.14
66 0.18
67 0.22
68 0.29
69 0.33
70 0.36
71 0.38
72 0.4
73 0.45
74 0.48
75 0.52
76 0.56
77 0.57
78 0.6
79 0.6
80 0.61
81 0.58
82 0.56
83 0.57
84 0.5
85 0.51
86 0.55
87 0.56
88 0.6
89 0.63
90 0.63
91 0.64
92 0.71
93 0.76
94 0.75
95 0.82
96 0.84
97 0.84
98 0.86
99 0.82
100 0.79