Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E3HQS3

Protein Details
Accession A0A1E3HQS3    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
5-32AADKKEVKKAAPKQKREKMDPNKPKQALHydrophilic
NLS Segment(s)
PositionSequence
8-27KKEVKKAAPKQKREKMDPNK
Subcellular Location(s) nucl 21.5, cyto_nucl 13, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
Amino Acid Sequences MLTAAADKKEVKKAAPKQKREKMDPNKPKQALSAYMFFDQDNRERIMAEYPGATFDHVGKLLGLRWKEMSDSEKEVCLSSSSPLSCLSCLSCLSRAPPDMCLSPTTRRPPPT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.66
3 0.72
4 0.75
5 0.82
6 0.86
7 0.85
8 0.86
9 0.85
10 0.86
11 0.87
12 0.85
13 0.87
14 0.79
15 0.72
16 0.64
17 0.57
18 0.51
19 0.44
20 0.38
21 0.31
22 0.3
23 0.3
24 0.26
25 0.24
26 0.2
27 0.2
28 0.18
29 0.17
30 0.16
31 0.16
32 0.17
33 0.17
34 0.15
35 0.13
36 0.1
37 0.09
38 0.1
39 0.1
40 0.09
41 0.07
42 0.07
43 0.07
44 0.07
45 0.07
46 0.06
47 0.06
48 0.08
49 0.12
50 0.11
51 0.11
52 0.12
53 0.12
54 0.13
55 0.15
56 0.16
57 0.16
58 0.2
59 0.2
60 0.2
61 0.2
62 0.2
63 0.18
64 0.17
65 0.14
66 0.11
67 0.14
68 0.13
69 0.13
70 0.15
71 0.15
72 0.14
73 0.15
74 0.15
75 0.13
76 0.14
77 0.16
78 0.17
79 0.17
80 0.2
81 0.24
82 0.27
83 0.27
84 0.28
85 0.29
86 0.3
87 0.3
88 0.3
89 0.29
90 0.32
91 0.39
92 0.44