Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3I4W3

Protein Details
Accession A0A1E3I4W3    Localization Confidence Low Confidence Score 5.8
NoLS Segment(s)
PositionSequenceProtein Nature
60-84YPCNKDYKDAKGKHQERKKGFRWVPBasic
NLS Segment(s)
Subcellular Location(s) extr 8, cyto 7.5, mito 7, cyto_nucl 6.5, nucl 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR029058  AB_hydrolase  
IPR016715  PAF_acetylhydro_eukaryote  
Gene Ontology GO:0003847  F:1-alkyl-2-acetylglycerophosphocholine esterase activity  
GO:0016042  P:lipid catabolic process  
Pfam View protein in Pfam  
PF03403  PAF-AH_p_II  
PROSITE View protein in PROSITE  
PS50007  PIPLC_X_DOMAIN  
Amino Acid Sequences MIPPILSFFLSLPSPPGPHPVGYAHITCPPIAPFAHPFPLLKSTSKPAFSLSHVGYAVFYPCNKDYKDAKGKHQERKKGFRWVPEPMSEIIKGYGKFAGGKGAVSWFVRPLGYFASRLLMPVYPLAPISPAQRPSAGYPLIIFSHGLAGTRHTYSQYCAALASEGYVVLAVEHRDGSGPAVMLPPDKEGGEPKVLYYTGVDDIQWEEGEEQPVNHARTLQLEMRSREVYEVYKSFINLTSVTPNPELEKTVVIEKLEGNDKQEERQAWINGLKGRVDGDDLRLVGHSFGGGTMLHLLQTSVPHPYTPLPTTQALVLDPWLDPLPFPSDILSAPSSPTAEHKILPPLFVVNSPGFTEWEEHFSRLVDIAKGWKNGEKNGAGLVTLLGIGHQSFSDFPLLSPTPAHARSMLSSIHTLSAAFLASPSTLASLPEIQGQKPDGGQYEHEEKGNGEGERLMKGKKGRDGEVVVHLLADDQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.2
3 0.26
4 0.25
5 0.25
6 0.28
7 0.26
8 0.28
9 0.29
10 0.3
11 0.26
12 0.29
13 0.29
14 0.27
15 0.26
16 0.23
17 0.22
18 0.2
19 0.22
20 0.22
21 0.26
22 0.31
23 0.3
24 0.3
25 0.31
26 0.37
27 0.36
28 0.33
29 0.32
30 0.35
31 0.4
32 0.42
33 0.39
34 0.36
35 0.36
36 0.37
37 0.4
38 0.34
39 0.32
40 0.3
41 0.3
42 0.26
43 0.24
44 0.23
45 0.17
46 0.17
47 0.17
48 0.19
49 0.25
50 0.25
51 0.3
52 0.33
53 0.41
54 0.52
55 0.52
56 0.59
57 0.65
58 0.73
59 0.77
60 0.81
61 0.81
62 0.8
63 0.85
64 0.82
65 0.82
66 0.77
67 0.77
68 0.73
69 0.72
70 0.67
71 0.6
72 0.57
73 0.47
74 0.46
75 0.36
76 0.32
77 0.25
78 0.24
79 0.21
80 0.19
81 0.19
82 0.16
83 0.17
84 0.17
85 0.2
86 0.16
87 0.16
88 0.15
89 0.16
90 0.17
91 0.17
92 0.17
93 0.13
94 0.14
95 0.14
96 0.13
97 0.13
98 0.15
99 0.16
100 0.16
101 0.15
102 0.17
103 0.16
104 0.17
105 0.17
106 0.12
107 0.11
108 0.12
109 0.12
110 0.1
111 0.1
112 0.09
113 0.09
114 0.1
115 0.13
116 0.17
117 0.19
118 0.2
119 0.21
120 0.23
121 0.24
122 0.28
123 0.25
124 0.2
125 0.18
126 0.19
127 0.18
128 0.17
129 0.14
130 0.08
131 0.11
132 0.11
133 0.11
134 0.09
135 0.11
136 0.13
137 0.14
138 0.15
139 0.13
140 0.14
141 0.15
142 0.2
143 0.18
144 0.16
145 0.15
146 0.15
147 0.14
148 0.13
149 0.12
150 0.06
151 0.05
152 0.05
153 0.05
154 0.04
155 0.04
156 0.05
157 0.05
158 0.05
159 0.05
160 0.05
161 0.06
162 0.06
163 0.07
164 0.07
165 0.07
166 0.07
167 0.08
168 0.08
169 0.08
170 0.09
171 0.09
172 0.09
173 0.09
174 0.09
175 0.1
176 0.13
177 0.15
178 0.14
179 0.14
180 0.15
181 0.15
182 0.14
183 0.12
184 0.12
185 0.1
186 0.1
187 0.1
188 0.08
189 0.09
190 0.09
191 0.09
192 0.07
193 0.06
194 0.07
195 0.09
196 0.08
197 0.08
198 0.09
199 0.14
200 0.14
201 0.14
202 0.13
203 0.12
204 0.14
205 0.18
206 0.19
207 0.2
208 0.24
209 0.25
210 0.27
211 0.28
212 0.25
213 0.23
214 0.21
215 0.17
216 0.15
217 0.15
218 0.13
219 0.13
220 0.13
221 0.13
222 0.13
223 0.13
224 0.11
225 0.11
226 0.13
227 0.13
228 0.15
229 0.14
230 0.14
231 0.14
232 0.14
233 0.14
234 0.11
235 0.11
236 0.1
237 0.12
238 0.13
239 0.11
240 0.11
241 0.1
242 0.12
243 0.15
244 0.14
245 0.14
246 0.17
247 0.18
248 0.18
249 0.22
250 0.2
251 0.19
252 0.24
253 0.22
254 0.2
255 0.21
256 0.23
257 0.22
258 0.22
259 0.2
260 0.16
261 0.16
262 0.14
263 0.14
264 0.12
265 0.12
266 0.13
267 0.12
268 0.12
269 0.12
270 0.12
271 0.1
272 0.09
273 0.06
274 0.04
275 0.04
276 0.05
277 0.04
278 0.04
279 0.05
280 0.05
281 0.05
282 0.05
283 0.06
284 0.05
285 0.07
286 0.07
287 0.09
288 0.09
289 0.09
290 0.11
291 0.13
292 0.16
293 0.16
294 0.18
295 0.18
296 0.19
297 0.19
298 0.19
299 0.18
300 0.14
301 0.13
302 0.11
303 0.09
304 0.08
305 0.09
306 0.09
307 0.08
308 0.07
309 0.09
310 0.12
311 0.11
312 0.12
313 0.11
314 0.11
315 0.12
316 0.15
317 0.15
318 0.11
319 0.12
320 0.12
321 0.12
322 0.11
323 0.14
324 0.16
325 0.16
326 0.17
327 0.19
328 0.26
329 0.26
330 0.27
331 0.24
332 0.21
333 0.2
334 0.2
335 0.21
336 0.13
337 0.14
338 0.14
339 0.14
340 0.13
341 0.13
342 0.16
343 0.13
344 0.19
345 0.19
346 0.19
347 0.18
348 0.18
349 0.18
350 0.17
351 0.18
352 0.13
353 0.12
354 0.19
355 0.23
356 0.25
357 0.26
358 0.28
359 0.29
360 0.31
361 0.37
362 0.3
363 0.26
364 0.26
365 0.25
366 0.21
367 0.18
368 0.15
369 0.09
370 0.08
371 0.07
372 0.04
373 0.05
374 0.05
375 0.05
376 0.05
377 0.05
378 0.06
379 0.07
380 0.11
381 0.1
382 0.11
383 0.17
384 0.18
385 0.18
386 0.18
387 0.19
388 0.23
389 0.24
390 0.25
391 0.2
392 0.21
393 0.22
394 0.24
395 0.23
396 0.19
397 0.19
398 0.19
399 0.19
400 0.17
401 0.15
402 0.13
403 0.12
404 0.1
405 0.08
406 0.07
407 0.07
408 0.07
409 0.07
410 0.07
411 0.08
412 0.08
413 0.08
414 0.11
415 0.13
416 0.13
417 0.2
418 0.22
419 0.2
420 0.24
421 0.25
422 0.24
423 0.23
424 0.25
425 0.22
426 0.22
427 0.24
428 0.27
429 0.32
430 0.32
431 0.32
432 0.3
433 0.27
434 0.29
435 0.32
436 0.26
437 0.2
438 0.22
439 0.22
440 0.26
441 0.28
442 0.25
443 0.25
444 0.31
445 0.37
446 0.42
447 0.46
448 0.46
449 0.51
450 0.54
451 0.53
452 0.54
453 0.49
454 0.41
455 0.35