Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E3HKJ2

Protein Details
Accession A0A1E3HKJ2    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
67-87DVENNRHWHKHQKWDKPPGSYHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 11, extr 8, mito 4, E.R. 2, mito_nucl 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MPPQRQPQQHPTQSAHPEQGPVAHGEWVQPPDHVVRSRALRRFWTAFFWAWLIWTVIGLIIGGGVSDVENNRHWHKHQKWDKPPGSY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.57
3 0.47
4 0.41
5 0.35
6 0.32
7 0.25
8 0.2
9 0.18
10 0.14
11 0.14
12 0.14
13 0.16
14 0.16
15 0.15
16 0.13
17 0.13
18 0.14
19 0.18
20 0.18
21 0.16
22 0.18
23 0.25
24 0.31
25 0.35
26 0.35
27 0.34
28 0.37
29 0.38
30 0.35
31 0.32
32 0.28
33 0.24
34 0.22
35 0.2
36 0.16
37 0.13
38 0.13
39 0.1
40 0.07
41 0.06
42 0.06
43 0.05
44 0.05
45 0.04
46 0.03
47 0.02
48 0.02
49 0.02
50 0.02
51 0.02
52 0.02
53 0.04
54 0.05
55 0.07
56 0.1
57 0.15
58 0.2
59 0.24
60 0.28
61 0.38
62 0.45
63 0.53
64 0.61
65 0.68
66 0.74
67 0.81