Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3HWU4

Protein Details
Accession A0A1E3HWU4   
Localization Confidence Medium
Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MTFKRRGGGRNKKGRGHVKNVRCSNCHydrophilic
NLS Segment(s)
PositionSequence
4-17KRRGGGRNKKGRGH
87-112RSAKPGAINSRKNRAPPPRAIFKDGK
Subcellular Location(s) mito 10, nucl 9, cyto_mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
PROSITE View protein in PROSITE  
PS00733  RIBOSOMAL_S26E  
Amino Acid Sequences MTFKRRGGGRNKKGRGHVKNVRCSNCSRCVPKDKAIKRFTVKNMVEAAAVRDLSEASVYQEYALPKLYIRLAYCISCAIHAKIVRVRSAKPGAINSRKNRAPPPRAIFKDGKRVNPAVAAAMAAKTAQA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.82
3 0.81
4 0.8
5 0.78
6 0.81
7 0.83
8 0.79
9 0.71
10 0.68
11 0.64
12 0.63
13 0.62
14 0.58
15 0.56
16 0.6
17 0.63
18 0.65
19 0.69
20 0.68
21 0.7
22 0.68
23 0.68
24 0.63
25 0.66
26 0.62
27 0.62
28 0.55
29 0.48
30 0.46
31 0.39
32 0.35
33 0.27
34 0.24
35 0.15
36 0.14
37 0.11
38 0.09
39 0.08
40 0.07
41 0.08
42 0.06
43 0.06
44 0.06
45 0.06
46 0.06
47 0.09
48 0.09
49 0.09
50 0.1
51 0.08
52 0.08
53 0.09
54 0.1
55 0.1
56 0.1
57 0.12
58 0.12
59 0.13
60 0.13
61 0.13
62 0.12
63 0.12
64 0.13
65 0.11
66 0.14
67 0.15
68 0.17
69 0.19
70 0.21
71 0.25
72 0.25
73 0.26
74 0.29
75 0.33
76 0.32
77 0.31
78 0.36
79 0.41
80 0.48
81 0.55
82 0.53
83 0.57
84 0.58
85 0.6
86 0.62
87 0.63
88 0.62
89 0.63
90 0.65
91 0.67
92 0.68
93 0.71
94 0.7
95 0.65
96 0.69
97 0.64
98 0.64
99 0.59
100 0.57
101 0.52
102 0.47
103 0.41
104 0.32
105 0.27
106 0.21
107 0.15
108 0.14
109 0.12