Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E3I8N7

Protein Details
Accession A0A1E3I8N7    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
92-111VSRIHPGRPQRQQSLPKRMLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, nucl 10, cyto 4
Family & Domain DBs
Amino Acid Sequences MPLQYASITVRPQASAQYEYFNKIVRRHHVVKEDSASHLTFLSPSRSTIRITPRWLLSATDVLIMPTYTSSQAVLPRVDCVPLECGLWLYPVSRIHPGRPQRQQSLPKRMLPSLYAPYLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.24
3 0.23
4 0.27
5 0.27
6 0.3
7 0.31
8 0.31
9 0.31
10 0.32
11 0.38
12 0.38
13 0.45
14 0.48
15 0.53
16 0.56
17 0.55
18 0.54
19 0.53
20 0.48
21 0.42
22 0.38
23 0.32
24 0.24
25 0.21
26 0.17
27 0.13
28 0.12
29 0.14
30 0.12
31 0.14
32 0.16
33 0.18
34 0.19
35 0.23
36 0.29
37 0.3
38 0.33
39 0.35
40 0.33
41 0.33
42 0.32
43 0.28
44 0.21
45 0.18
46 0.14
47 0.12
48 0.11
49 0.09
50 0.08
51 0.08
52 0.06
53 0.05
54 0.05
55 0.05
56 0.05
57 0.06
58 0.07
59 0.1
60 0.12
61 0.13
62 0.12
63 0.14
64 0.14
65 0.14
66 0.12
67 0.11
68 0.12
69 0.11
70 0.11
71 0.09
72 0.1
73 0.09
74 0.11
75 0.09
76 0.08
77 0.11
78 0.13
79 0.16
80 0.23
81 0.24
82 0.27
83 0.36
84 0.44
85 0.5
86 0.57
87 0.63
88 0.62
89 0.7
90 0.76
91 0.78
92 0.8
93 0.77
94 0.74
95 0.72
96 0.67
97 0.61
98 0.53
99 0.5
100 0.45