Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3HCL7

Protein Details
Accession A0A1E3HCL7   
Localization Confidence Medium
Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
125-148RSLRICSRPGRRKAPSMQRKELKSHydrophilic
NLS Segment(s)
PositionSequence
47-57RKPRLYRRRTH
136-137RK
Subcellular Location(s) mito 15, nucl 10
Family & Domain DBs
Amino Acid Sequences MSSQPKMLPLCTLPSVHGYDRPHQPCRYHACGGCRRAPPRPGTTDFRKPRLYRRRTHARMLGLARRRYARWDWDWLDTSPSPGRAEDRKVAHESLPSGRGKAGGGEWSYMGFRGVNWSPQRPQTRSLRICSRPGRRKAPSMQRKELKSTGRIVV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.29
3 0.27
4 0.31
5 0.3
6 0.34
7 0.43
8 0.48
9 0.51
10 0.51
11 0.52
12 0.54
13 0.59
14 0.59
15 0.55
16 0.53
17 0.55
18 0.59
19 0.62
20 0.62
21 0.6
22 0.58
23 0.58
24 0.61
25 0.58
26 0.56
27 0.57
28 0.55
29 0.55
30 0.59
31 0.63
32 0.62
33 0.62
34 0.64
35 0.59
36 0.64
37 0.68
38 0.68
39 0.65
40 0.68
41 0.73
42 0.7
43 0.75
44 0.7
45 0.62
46 0.61
47 0.57
48 0.55
49 0.51
50 0.48
51 0.43
52 0.4
53 0.37
54 0.35
55 0.34
56 0.33
57 0.29
58 0.34
59 0.34
60 0.35
61 0.37
62 0.32
63 0.33
64 0.26
65 0.26
66 0.19
67 0.19
68 0.16
69 0.14
70 0.17
71 0.16
72 0.2
73 0.23
74 0.24
75 0.27
76 0.29
77 0.29
78 0.27
79 0.26
80 0.24
81 0.21
82 0.24
83 0.2
84 0.18
85 0.17
86 0.17
87 0.16
88 0.14
89 0.13
90 0.11
91 0.12
92 0.12
93 0.12
94 0.12
95 0.12
96 0.11
97 0.11
98 0.07
99 0.06
100 0.12
101 0.13
102 0.2
103 0.23
104 0.28
105 0.31
106 0.39
107 0.47
108 0.44
109 0.49
110 0.51
111 0.59
112 0.59
113 0.63
114 0.65
115 0.62
116 0.69
117 0.72
118 0.73
119 0.72
120 0.76
121 0.78
122 0.75
123 0.78
124 0.8
125 0.81
126 0.81
127 0.81
128 0.83
129 0.81
130 0.8
131 0.79
132 0.76
133 0.72
134 0.66