Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3HQ50

Protein Details
Accession A0A1E3HQ50    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
216-242VPSTGCTSPTRRRSPKPRRVPSLPSLYHydrophilic
NLS Segment(s)
PositionSequence
228-232RSPKP
Subcellular Location(s) nucl 14, mito 12, cyto_nucl 8.5
Family & Domain DBs
Amino Acid Sequences MSLAGRLSLRPRSLPKLARATAADYMTDDVATPSSDKQALNSTPVAGIAPTTPVAVTTSPVWAFFSTNQSISPQPQAPSVDEMTTRMADLMLSISTMGDEAFEAAFRSALYEQAASNSTTPTTPTTSITPTTSTTPTTPPTLSAPGSPKRKRDSVDEEGHKCSTPTTHSSPSFTPCGASLGRSWCETSCCSAKRPCIQRYIAQTCGRYVKRQINRVPSTGCTSPTRRRSPKPRRVPSLPSLYFPPPSPFPLGDIPVPVHVSPSEDCEDPADAFLAAFMSKMGIASAEEQDEDMVVKIESGSSVDMVMA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.59
3 0.63
4 0.61
5 0.6
6 0.55
7 0.52
8 0.48
9 0.42
10 0.34
11 0.25
12 0.25
13 0.21
14 0.19
15 0.14
16 0.1
17 0.09
18 0.1
19 0.1
20 0.1
21 0.13
22 0.16
23 0.16
24 0.17
25 0.24
26 0.25
27 0.28
28 0.27
29 0.25
30 0.22
31 0.22
32 0.2
33 0.12
34 0.11
35 0.08
36 0.09
37 0.08
38 0.08
39 0.08
40 0.08
41 0.1
42 0.09
43 0.1
44 0.1
45 0.13
46 0.13
47 0.14
48 0.15
49 0.14
50 0.15
51 0.16
52 0.21
53 0.2
54 0.2
55 0.2
56 0.21
57 0.22
58 0.23
59 0.26
60 0.23
61 0.22
62 0.25
63 0.27
64 0.26
65 0.28
66 0.27
67 0.23
68 0.2
69 0.2
70 0.19
71 0.17
72 0.15
73 0.11
74 0.1
75 0.08
76 0.08
77 0.07
78 0.05
79 0.05
80 0.05
81 0.04
82 0.04
83 0.05
84 0.04
85 0.03
86 0.03
87 0.04
88 0.04
89 0.04
90 0.05
91 0.05
92 0.05
93 0.05
94 0.07
95 0.06
96 0.07
97 0.08
98 0.08
99 0.08
100 0.1
101 0.11
102 0.1
103 0.1
104 0.1
105 0.09
106 0.09
107 0.1
108 0.1
109 0.12
110 0.12
111 0.13
112 0.15
113 0.17
114 0.18
115 0.18
116 0.18
117 0.16
118 0.18
119 0.18
120 0.17
121 0.16
122 0.17
123 0.18
124 0.19
125 0.17
126 0.16
127 0.17
128 0.18
129 0.17
130 0.17
131 0.21
132 0.26
133 0.35
134 0.38
135 0.41
136 0.43
137 0.47
138 0.46
139 0.48
140 0.49
141 0.47
142 0.52
143 0.53
144 0.52
145 0.5
146 0.49
147 0.41
148 0.33
149 0.25
150 0.18
151 0.15
152 0.17
153 0.19
154 0.25
155 0.26
156 0.29
157 0.3
158 0.31
159 0.3
160 0.25
161 0.2
162 0.14
163 0.16
164 0.14
165 0.13
166 0.12
167 0.15
168 0.16
169 0.16
170 0.17
171 0.15
172 0.17
173 0.17
174 0.19
175 0.21
176 0.22
177 0.25
178 0.29
179 0.35
180 0.41
181 0.48
182 0.48
183 0.5
184 0.51
185 0.52
186 0.58
187 0.57
188 0.56
189 0.51
190 0.48
191 0.43
192 0.48
193 0.44
194 0.38
195 0.39
196 0.41
197 0.44
198 0.52
199 0.56
200 0.59
201 0.61
202 0.61
203 0.57
204 0.49
205 0.48
206 0.41
207 0.38
208 0.32
209 0.35
210 0.41
211 0.48
212 0.56
213 0.58
214 0.67
215 0.75
216 0.81
217 0.86
218 0.88
219 0.88
220 0.87
221 0.86
222 0.84
223 0.8
224 0.8
225 0.7
226 0.61
227 0.56
228 0.5
229 0.44
230 0.38
231 0.35
232 0.27
233 0.28
234 0.3
235 0.25
236 0.26
237 0.28
238 0.29
239 0.25
240 0.25
241 0.23
242 0.21
243 0.23
244 0.19
245 0.17
246 0.14
247 0.17
248 0.15
249 0.19
250 0.2
251 0.18
252 0.19
253 0.19
254 0.21
255 0.18
256 0.18
257 0.14
258 0.11
259 0.1
260 0.1
261 0.08
262 0.06
263 0.06
264 0.05
265 0.05
266 0.05
267 0.05
268 0.05
269 0.05
270 0.06
271 0.09
272 0.11
273 0.12
274 0.12
275 0.12
276 0.12
277 0.12
278 0.11
279 0.09
280 0.08
281 0.07
282 0.07
283 0.07
284 0.07
285 0.07
286 0.08
287 0.08
288 0.08