Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3HHT5

Protein Details
Accession A0A1E3HHT5    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
75-97LIEEEKQKEKERKERERLKSEALBasic
NLS Segment(s)
PositionSequence
84-89KERKER
Subcellular Location(s) nucl 20.5, cyto_nucl 13.333, cyto 5, cyto_mito 3.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR027532  Mdm12  
IPR031468  SMP_LBD  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0032865  C:ERMES complex  
GO:0008289  F:lipid binding  
GO:0006869  P:lipid transport  
GO:0000002  P:mitochondrial genome maintenance  
GO:0045040  P:protein insertion into mitochondrial outer membrane  
PROSITE View protein in PROSITE  
PS51847  SMP  
CDD cd21672  SMP_Mdm12  
Amino Acid Sequences MSLDINWDLLSPTDHLQDSLITLLNAHLANAARPSFIGPVTVTAFDFGTAAPDLEIRDIRDVWRVFDQGDEEGDLIEEEKQKEKERKERERLKSEALKSSLDGEKYEMVDYYSPTSEGGESYDEQFEYDLEQQLEAEERARQRGRRPNSYAPTSYPDRPAVHRSMSARSFIPYPFDHPVRTPYLPSTPGLNPSLFSHPLSVRRNPLSASQSVAPIPSRRRLPIAPSSTPPSPPAHPAGLPPSKPASSVPSLQLHLHLSHTSDLHLTLLTSLQVNYPSQLFMALPLKISITGFHIDADVVLAFNGEKNRVHLTVVDEESGQGPMGGMGGEDKNLSIGQRLLPNLQIESEIGHADAHVLRNVGKVERFILDVVRKTMVDELVFPNFHTVAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.17
4 0.17
5 0.16
6 0.16
7 0.15
8 0.1
9 0.1
10 0.1
11 0.13
12 0.13
13 0.12
14 0.13
15 0.12
16 0.14
17 0.17
18 0.18
19 0.14
20 0.15
21 0.16
22 0.16
23 0.15
24 0.16
25 0.12
26 0.15
27 0.17
28 0.18
29 0.16
30 0.15
31 0.15
32 0.13
33 0.13
34 0.09
35 0.09
36 0.09
37 0.09
38 0.08
39 0.09
40 0.09
41 0.12
42 0.14
43 0.13
44 0.16
45 0.16
46 0.17
47 0.25
48 0.25
49 0.25
50 0.28
51 0.27
52 0.24
53 0.25
54 0.25
55 0.18
56 0.19
57 0.16
58 0.12
59 0.11
60 0.11
61 0.09
62 0.08
63 0.1
64 0.12
65 0.13
66 0.19
67 0.22
68 0.3
69 0.38
70 0.46
71 0.53
72 0.6
73 0.69
74 0.75
75 0.82
76 0.84
77 0.85
78 0.81
79 0.79
80 0.77
81 0.71
82 0.68
83 0.59
84 0.5
85 0.43
86 0.43
87 0.38
88 0.3
89 0.26
90 0.2
91 0.2
92 0.2
93 0.2
94 0.15
95 0.13
96 0.13
97 0.14
98 0.14
99 0.12
100 0.11
101 0.11
102 0.12
103 0.11
104 0.1
105 0.1
106 0.1
107 0.1
108 0.12
109 0.13
110 0.12
111 0.12
112 0.11
113 0.1
114 0.1
115 0.11
116 0.12
117 0.11
118 0.11
119 0.11
120 0.11
121 0.13
122 0.1
123 0.09
124 0.1
125 0.11
126 0.18
127 0.21
128 0.24
129 0.31
130 0.41
131 0.47
132 0.53
133 0.6
134 0.63
135 0.66
136 0.69
137 0.62
138 0.55
139 0.53
140 0.48
141 0.43
142 0.37
143 0.34
144 0.31
145 0.32
146 0.34
147 0.32
148 0.3
149 0.31
150 0.29
151 0.31
152 0.3
153 0.29
154 0.24
155 0.22
156 0.22
157 0.19
158 0.2
159 0.15
160 0.18
161 0.21
162 0.21
163 0.21
164 0.2
165 0.24
166 0.25
167 0.25
168 0.22
169 0.19
170 0.21
171 0.22
172 0.21
173 0.21
174 0.17
175 0.2
176 0.21
177 0.18
178 0.16
179 0.17
180 0.2
181 0.17
182 0.17
183 0.16
184 0.16
185 0.24
186 0.27
187 0.27
188 0.29
189 0.29
190 0.29
191 0.28
192 0.31
193 0.27
194 0.24
195 0.23
196 0.19
197 0.19
198 0.18
199 0.18
200 0.15
201 0.15
202 0.18
203 0.2
204 0.22
205 0.22
206 0.26
207 0.26
208 0.31
209 0.36
210 0.39
211 0.37
212 0.37
213 0.4
214 0.38
215 0.38
216 0.34
217 0.28
218 0.23
219 0.24
220 0.24
221 0.21
222 0.2
223 0.21
224 0.27
225 0.28
226 0.27
227 0.26
228 0.26
229 0.24
230 0.25
231 0.24
232 0.22
233 0.2
234 0.22
235 0.24
236 0.24
237 0.25
238 0.25
239 0.25
240 0.22
241 0.2
242 0.19
243 0.16
244 0.14
245 0.14
246 0.14
247 0.13
248 0.11
249 0.11
250 0.1
251 0.09
252 0.07
253 0.06
254 0.07
255 0.06
256 0.06
257 0.07
258 0.07
259 0.09
260 0.09
261 0.1
262 0.1
263 0.1
264 0.09
265 0.09
266 0.08
267 0.1
268 0.13
269 0.12
270 0.12
271 0.12
272 0.12
273 0.12
274 0.13
275 0.1
276 0.1
277 0.11
278 0.11
279 0.11
280 0.11
281 0.1
282 0.1
283 0.1
284 0.07
285 0.05
286 0.05
287 0.05
288 0.04
289 0.07
290 0.09
291 0.1
292 0.11
293 0.13
294 0.18
295 0.18
296 0.19
297 0.19
298 0.22
299 0.27
300 0.27
301 0.25
302 0.21
303 0.21
304 0.21
305 0.19
306 0.15
307 0.08
308 0.06
309 0.05
310 0.06
311 0.05
312 0.04
313 0.06
314 0.06
315 0.07
316 0.07
317 0.07
318 0.08
319 0.09
320 0.09
321 0.09
322 0.1
323 0.13
324 0.18
325 0.2
326 0.21
327 0.23
328 0.25
329 0.24
330 0.22
331 0.2
332 0.16
333 0.15
334 0.15
335 0.12
336 0.1
337 0.09
338 0.09
339 0.1
340 0.12
341 0.13
342 0.13
343 0.14
344 0.14
345 0.18
346 0.2
347 0.22
348 0.21
349 0.21
350 0.22
351 0.23
352 0.24
353 0.21
354 0.26
355 0.28
356 0.3
357 0.31
358 0.31
359 0.29
360 0.29
361 0.32
362 0.28
363 0.23
364 0.23
365 0.24
366 0.27
367 0.28
368 0.27
369 0.26