Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3HCX3

Protein Details
Accession A0A1E3HCX3   
Localization Confidence Medium
Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
258-286APKAVAAAPVKKKKRNTRALKITNTHMKEHydrophilic
NLS Segment(s)
PositionSequence
266-274PVKKKKRNT
Subcellular Location(s) nucl 14, mito 7, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR040501  TFA2_Winged_2  
IPR016656  TFIIE-bsu  
Gene Ontology GO:0005673  C:transcription factor TFIIE complex  
GO:0006367  P:transcription initiation at RNA polymerase II promoter  
Pfam View protein in Pfam  
PF18121  TFA2_Winged_2  
Amino Acid Sequences MIKGNKRQMPSWAQSSEPGTPGARSAKDEPQDEPDVKPDVKRVKTHLSGNHGMYQDTRTAAIDLLNILRKSVTMRYEDAYFRVQENSPGTDPTKALEILKGLERIEFNAGNQVFSYIPELTLITASEIRNHIRIHSTPTSGLSIKTLKEAMPNGIEPLKDLESRGDVMIMRGLGANYKDIPLPRLGRLNVNGEDLLGGPTTRWKMVFWDHLKEAGRAGKRVDDEFIFAWADVPIAETDDVTKLLADQELSASSLTPAAPKAVAAAPVKKKKRNTRALKITNTHMKEQGIDFSKDYVKGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.49
3 0.44
4 0.36
5 0.32
6 0.25
7 0.24
8 0.26
9 0.28
10 0.25
11 0.27
12 0.31
13 0.36
14 0.41
15 0.43
16 0.41
17 0.42
18 0.47
19 0.43
20 0.39
21 0.36
22 0.35
23 0.34
24 0.33
25 0.34
26 0.37
27 0.42
28 0.45
29 0.47
30 0.51
31 0.56
32 0.62
33 0.6
34 0.59
35 0.59
36 0.57
37 0.57
38 0.48
39 0.43
40 0.37
41 0.32
42 0.26
43 0.21
44 0.19
45 0.13
46 0.13
47 0.13
48 0.13
49 0.11
50 0.1
51 0.12
52 0.17
53 0.16
54 0.15
55 0.15
56 0.15
57 0.17
58 0.21
59 0.21
60 0.19
61 0.21
62 0.23
63 0.27
64 0.27
65 0.27
66 0.25
67 0.23
68 0.2
69 0.21
70 0.2
71 0.21
72 0.22
73 0.24
74 0.22
75 0.23
76 0.23
77 0.22
78 0.22
79 0.18
80 0.18
81 0.15
82 0.14
83 0.13
84 0.12
85 0.12
86 0.15
87 0.16
88 0.13
89 0.14
90 0.14
91 0.14
92 0.16
93 0.15
94 0.13
95 0.18
96 0.18
97 0.16
98 0.16
99 0.16
100 0.13
101 0.13
102 0.15
103 0.08
104 0.08
105 0.08
106 0.09
107 0.08
108 0.08
109 0.07
110 0.06
111 0.09
112 0.09
113 0.11
114 0.12
115 0.13
116 0.16
117 0.16
118 0.16
119 0.17
120 0.18
121 0.22
122 0.24
123 0.24
124 0.21
125 0.22
126 0.23
127 0.2
128 0.2
129 0.15
130 0.14
131 0.13
132 0.14
133 0.13
134 0.11
135 0.13
136 0.14
137 0.13
138 0.13
139 0.12
140 0.12
141 0.13
142 0.13
143 0.11
144 0.12
145 0.12
146 0.11
147 0.11
148 0.11
149 0.11
150 0.12
151 0.11
152 0.1
153 0.08
154 0.08
155 0.09
156 0.08
157 0.07
158 0.06
159 0.06
160 0.07
161 0.07
162 0.08
163 0.07
164 0.08
165 0.09
166 0.09
167 0.11
168 0.14
169 0.16
170 0.17
171 0.22
172 0.22
173 0.24
174 0.27
175 0.3
176 0.27
177 0.26
178 0.24
179 0.19
180 0.18
181 0.15
182 0.13
183 0.08
184 0.07
185 0.05
186 0.09
187 0.1
188 0.1
189 0.11
190 0.1
191 0.14
192 0.19
193 0.29
194 0.29
195 0.33
196 0.33
197 0.38
198 0.39
199 0.36
200 0.34
201 0.31
202 0.3
203 0.26
204 0.26
205 0.26
206 0.26
207 0.27
208 0.26
209 0.21
210 0.21
211 0.2
212 0.2
213 0.16
214 0.14
215 0.13
216 0.1
217 0.1
218 0.07
219 0.08
220 0.06
221 0.07
222 0.07
223 0.06
224 0.08
225 0.09
226 0.09
227 0.08
228 0.08
229 0.07
230 0.08
231 0.09
232 0.08
233 0.07
234 0.08
235 0.09
236 0.1
237 0.09
238 0.08
239 0.08
240 0.09
241 0.09
242 0.09
243 0.09
244 0.1
245 0.1
246 0.09
247 0.12
248 0.12
249 0.18
250 0.2
251 0.28
252 0.36
253 0.46
254 0.55
255 0.6
256 0.68
257 0.74
258 0.81
259 0.84
260 0.85
261 0.86
262 0.89
263 0.91
264 0.91
265 0.85
266 0.83
267 0.82
268 0.75
269 0.68
270 0.61
271 0.52
272 0.46
273 0.43
274 0.42
275 0.37
276 0.36
277 0.33
278 0.32
279 0.35