Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3I6F8

Protein Details
Accession A0A1E3I6F8   
Localization Confidence Medium
Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
11-37QNQQPSTSTKAKKPRPKKANGGPSHLSHydrophilic
NLS Segment(s)
PositionSequence
20-32KAKKPRPKKANGG
Subcellular Location(s) nucl 21.5, cyto_nucl 13.5, mito 3
Family & Domain DBs
Amino Acid Sequences MDSLPIAFGKQNQQPSTSTKAKKPRPKKANGGPSHLSHPQLPPKPPQSAQGRGSNQTELGRRGAAGSSWIAGAEKRKEEANGGAASSKRPRQSNGAGAGRYDAGPKGNHSRRGQNIRYLLAEHMFEDPWARLPFKQSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.41
3 0.46
4 0.48
5 0.47
6 0.47
7 0.56
8 0.64
9 0.72
10 0.78
11 0.81
12 0.82
13 0.86
14 0.88
15 0.88
16 0.89
17 0.84
18 0.8
19 0.73
20 0.65
21 0.62
22 0.54
23 0.45
24 0.36
25 0.36
26 0.37
27 0.39
28 0.4
29 0.41
30 0.43
31 0.47
32 0.46
33 0.48
34 0.46
35 0.48
36 0.49
37 0.51
38 0.49
39 0.47
40 0.47
41 0.4
42 0.35
43 0.3
44 0.29
45 0.21
46 0.2
47 0.16
48 0.14
49 0.14
50 0.13
51 0.09
52 0.08
53 0.07
54 0.06
55 0.06
56 0.06
57 0.05
58 0.06
59 0.09
60 0.11
61 0.11
62 0.12
63 0.13
64 0.13
65 0.15
66 0.16
67 0.16
68 0.14
69 0.13
70 0.14
71 0.14
72 0.16
73 0.19
74 0.22
75 0.23
76 0.24
77 0.27
78 0.31
79 0.37
80 0.41
81 0.45
82 0.46
83 0.41
84 0.4
85 0.38
86 0.32
87 0.27
88 0.21
89 0.14
90 0.11
91 0.12
92 0.16
93 0.25
94 0.31
95 0.4
96 0.42
97 0.5
98 0.57
99 0.66
100 0.66
101 0.64
102 0.62
103 0.56
104 0.54
105 0.47
106 0.4
107 0.32
108 0.29
109 0.22
110 0.19
111 0.16
112 0.15
113 0.15
114 0.14
115 0.18
116 0.2
117 0.21
118 0.21