Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3I020

Protein Details
Accession A0A1E3I020   
Localization Confidence Medium
Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
269-297LGKPDAPISKPKSRPKQKSNKRQRQAGFKHydrophilic
NLS Segment(s)
PositionSequence
276-297ISKPKSRPKQKSNKRQRQAGFK
Subcellular Location(s) nucl 10.5, cyto_nucl 9, cysk 7, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036770  Ankyrin_rpt-contain_sf  
Amino Acid Sequences MDLAHLPVELIQHIHVLAHNPFLPHTCRYIYASLHGTSPHYTAAYLLSLYSPYGPSEILVRALRHPVCDIDVALALNEQWEKRRRMGNGKSTVTSLDPMLGKRARSKWGSASPEPAIRPLAVRELPRRLFRVSKPEPPIHPMITYLFETYSPSPNSHKGYPLCRAVLQHNLPLISFLLVHGADPSLKDFMAVEIAISMKDLQMVKMLIERQPGEETKTDSPAKRVKLGDRVTVGTRMVETAIKKGANEIVNYLVHDKKVMPPLQSIMELGKPDAPISKPKSRPKQKSNKRQRQAGFK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.14
4 0.14
5 0.18
6 0.19
7 0.19
8 0.2
9 0.22
10 0.25
11 0.23
12 0.26
13 0.24
14 0.25
15 0.28
16 0.31
17 0.29
18 0.31
19 0.33
20 0.29
21 0.29
22 0.27
23 0.25
24 0.23
25 0.23
26 0.19
27 0.15
28 0.14
29 0.13
30 0.14
31 0.12
32 0.1
33 0.09
34 0.08
35 0.08
36 0.09
37 0.1
38 0.09
39 0.08
40 0.09
41 0.09
42 0.09
43 0.11
44 0.11
45 0.15
46 0.17
47 0.18
48 0.19
49 0.26
50 0.27
51 0.25
52 0.26
53 0.23
54 0.22
55 0.21
56 0.19
57 0.13
58 0.14
59 0.12
60 0.11
61 0.1
62 0.07
63 0.08
64 0.09
65 0.08
66 0.14
67 0.2
68 0.24
69 0.28
70 0.34
71 0.39
72 0.47
73 0.56
74 0.6
75 0.62
76 0.62
77 0.58
78 0.53
79 0.49
80 0.4
81 0.31
82 0.22
83 0.15
84 0.14
85 0.13
86 0.18
87 0.19
88 0.19
89 0.24
90 0.28
91 0.31
92 0.32
93 0.34
94 0.35
95 0.41
96 0.47
97 0.42
98 0.43
99 0.39
100 0.41
101 0.38
102 0.33
103 0.25
104 0.19
105 0.18
106 0.14
107 0.17
108 0.16
109 0.19
110 0.22
111 0.28
112 0.31
113 0.33
114 0.35
115 0.33
116 0.35
117 0.35
118 0.41
119 0.39
120 0.44
121 0.47
122 0.49
123 0.47
124 0.46
125 0.47
126 0.37
127 0.33
128 0.25
129 0.21
130 0.18
131 0.17
132 0.14
133 0.11
134 0.1
135 0.11
136 0.12
137 0.15
138 0.14
139 0.14
140 0.17
141 0.21
142 0.24
143 0.23
144 0.28
145 0.26
146 0.3
147 0.33
148 0.34
149 0.3
150 0.28
151 0.29
152 0.26
153 0.31
154 0.28
155 0.25
156 0.23
157 0.22
158 0.21
159 0.2
160 0.17
161 0.1
162 0.08
163 0.06
164 0.07
165 0.06
166 0.06
167 0.06
168 0.06
169 0.06
170 0.06
171 0.08
172 0.06
173 0.06
174 0.06
175 0.06
176 0.06
177 0.08
178 0.07
179 0.06
180 0.05
181 0.06
182 0.05
183 0.06
184 0.06
185 0.04
186 0.07
187 0.08
188 0.07
189 0.1
190 0.1
191 0.1
192 0.13
193 0.15
194 0.14
195 0.18
196 0.18
197 0.18
198 0.21
199 0.22
200 0.22
201 0.22
202 0.25
203 0.24
204 0.29
205 0.32
206 0.29
207 0.35
208 0.38
209 0.39
210 0.41
211 0.42
212 0.42
213 0.47
214 0.49
215 0.48
216 0.45
217 0.45
218 0.41
219 0.39
220 0.34
221 0.25
222 0.22
223 0.16
224 0.15
225 0.15
226 0.14
227 0.15
228 0.18
229 0.18
230 0.18
231 0.2
232 0.24
233 0.24
234 0.24
235 0.22
236 0.22
237 0.22
238 0.24
239 0.25
240 0.21
241 0.19
242 0.19
243 0.19
244 0.21
245 0.29
246 0.32
247 0.3
248 0.31
249 0.34
250 0.35
251 0.35
252 0.3
253 0.23
254 0.23
255 0.22
256 0.2
257 0.2
258 0.17
259 0.17
260 0.21
261 0.21
262 0.27
263 0.34
264 0.43
265 0.49
266 0.59
267 0.7
268 0.77
269 0.85
270 0.87
271 0.91
272 0.92
273 0.94
274 0.96
275 0.96
276 0.94
277 0.93