Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3HAH9

Protein Details
Accession A0A1E3HAH9   
Localization Confidence Medium
Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
3-33VPQHPPPSPPKHQPATKKKKTQKTTNPDVASHydrophilic
NLS Segment(s)
PositionSequence
19-21KKK
Subcellular Location(s) nucl 11, mito_nucl 10.166, cyto_nucl 9.166, mito 8, cyto_mito 7.666, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR024752  Myb/SANT-like_dom  
Pfam View protein in Pfam  
PF12776  Myb_DNA-bind_3  
Amino Acid Sequences MSVPQHPPPSPPKHQPATKKKKTQKTTNPDVASVTPATASPTPGAPGTPGVAAAASTQDWSNKETLVMLRELVDRRLWILGAKVVHQDLAEEDSGTVLRTDKSLKGKINTLRKDYKLIATLLNDSSGFGWNDELKCVCHEDDFW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.78
3 0.8
4 0.83
5 0.85
6 0.86
7 0.87
8 0.89
9 0.9
10 0.91
11 0.9
12 0.89
13 0.88
14 0.87
15 0.79
16 0.7
17 0.62
18 0.52
19 0.44
20 0.34
21 0.24
22 0.14
23 0.12
24 0.15
25 0.13
26 0.13
27 0.11
28 0.11
29 0.12
30 0.12
31 0.12
32 0.09
33 0.09
34 0.09
35 0.08
36 0.08
37 0.06
38 0.06
39 0.06
40 0.05
41 0.05
42 0.05
43 0.05
44 0.05
45 0.07
46 0.08
47 0.1
48 0.1
49 0.09
50 0.09
51 0.1
52 0.1
53 0.1
54 0.1
55 0.08
56 0.09
57 0.11
58 0.12
59 0.12
60 0.11
61 0.1
62 0.1
63 0.1
64 0.09
65 0.07
66 0.07
67 0.09
68 0.09
69 0.1
70 0.1
71 0.1
72 0.1
73 0.1
74 0.09
75 0.07
76 0.09
77 0.08
78 0.07
79 0.07
80 0.07
81 0.07
82 0.07
83 0.07
84 0.05
85 0.06
86 0.07
87 0.09
88 0.14
89 0.2
90 0.26
91 0.3
92 0.33
93 0.4
94 0.47
95 0.55
96 0.56
97 0.57
98 0.59
99 0.56
100 0.59
101 0.54
102 0.51
103 0.44
104 0.4
105 0.35
106 0.3
107 0.31
108 0.26
109 0.25
110 0.2
111 0.17
112 0.16
113 0.16
114 0.15
115 0.12
116 0.14
117 0.17
118 0.18
119 0.2
120 0.21
121 0.19
122 0.2
123 0.24
124 0.22