Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3I222

Protein Details
Accession A0A1E3I222   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
58-78ELKESKKKSKHAKLDPANNRTHydrophilic
NLS Segment(s)
PositionSequence
51-70KKRKTGEELKESKKKSKHAK
Subcellular Location(s) nucl 16, cyto 5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR029188  Rrp14_N  
Pfam View protein in Pfam  
PF15459  RRP14  
Amino Acid Sequences MSATTQEIPADLYSSLEKHNAAFTQLLSLIPAQYYIALAPEEADSKWMINKKRKTGEELKESKKKSKHAKLDPANNRTTVEILAQEVWAAPPLAAPAPASPPFPLPPLSPN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.14
3 0.14
4 0.14
5 0.13
6 0.16
7 0.15
8 0.16
9 0.15
10 0.14
11 0.14
12 0.15
13 0.14
14 0.11
15 0.11
16 0.1
17 0.08
18 0.09
19 0.06
20 0.06
21 0.06
22 0.05
23 0.06
24 0.05
25 0.05
26 0.06
27 0.06
28 0.07
29 0.07
30 0.08
31 0.07
32 0.07
33 0.1
34 0.15
35 0.21
36 0.29
37 0.35
38 0.41
39 0.49
40 0.5
41 0.54
42 0.59
43 0.59
44 0.61
45 0.62
46 0.62
47 0.62
48 0.63
49 0.63
50 0.58
51 0.59
52 0.6
53 0.62
54 0.65
55 0.67
56 0.75
57 0.77
58 0.82
59 0.83
60 0.78
61 0.71
62 0.62
63 0.53
64 0.43
65 0.36
66 0.26
67 0.17
68 0.13
69 0.12
70 0.11
71 0.1
72 0.09
73 0.08
74 0.08
75 0.08
76 0.07
77 0.06
78 0.05
79 0.07
80 0.08
81 0.08
82 0.09
83 0.09
84 0.14
85 0.16
86 0.18
87 0.17
88 0.2
89 0.22
90 0.23
91 0.24