Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3HBF0

Protein Details
Accession A0A1E3HBF0    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
71-90FSLRRRGQRCHNIHNFRRDPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, extr 7, cyto_mito 7, mito_nucl 7
Family & Domain DBs
Amino Acid Sequences MVLYTFAQKRRNHVLLATLPLLFVAPSPLSKHRPFRFAFAASLSCYITPQEHYTPTVMERLDMYHNQSTLFSLRRRGQRCHNIHNFRRDPSSQRVACLHHSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.41
3 0.44
4 0.38
5 0.28
6 0.24
7 0.22
8 0.21
9 0.13
10 0.1
11 0.08
12 0.07
13 0.08
14 0.12
15 0.17
16 0.23
17 0.28
18 0.38
19 0.39
20 0.45
21 0.45
22 0.47
23 0.47
24 0.43
25 0.39
26 0.32
27 0.29
28 0.23
29 0.23
30 0.18
31 0.13
32 0.11
33 0.11
34 0.09
35 0.09
36 0.11
37 0.12
38 0.12
39 0.13
40 0.14
41 0.14
42 0.14
43 0.15
44 0.12
45 0.11
46 0.1
47 0.11
48 0.13
49 0.14
50 0.18
51 0.17
52 0.17
53 0.17
54 0.17
55 0.17
56 0.17
57 0.2
58 0.17
59 0.23
60 0.29
61 0.37
62 0.42
63 0.46
64 0.54
65 0.6
66 0.66
67 0.7
68 0.74
69 0.76
70 0.78
71 0.84
72 0.78
73 0.71
74 0.7
75 0.63
76 0.59
77 0.57
78 0.6
79 0.51
80 0.5
81 0.51
82 0.48