Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E3HEU5

Protein Details
Accession A0A1E3HEU5    Localization Confidence High Confidence Score 15.5
NoLS Segment(s)
PositionSequenceProtein Nature
5-35ATDKKEVKKAAPKQKREKKDPNKPKRALSAYBasic
NLS Segment(s)
PositionSequence
8-30KKEVKKAAPKQKREKKDPNKPKR
100-112PPEKKSKKAAPKQ
Subcellular Location(s) nucl 22, cyto_nucl 14, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
Amino Acid Sequences MPKAATDKKEVKKAAPKQKREKKDPNKPKRALSAYMFFVQDYRERIKTENPDATFGDVGKLLGLKWKEMSASEKEPYNKKADADKVRAEKDSAAYKADNPPEKKSKKAAPKQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.74
3 0.77
4 0.79
5 0.87
6 0.9
7 0.89
8 0.91
9 0.9
10 0.92
11 0.93
12 0.93
13 0.93
14 0.88
15 0.84
16 0.82
17 0.76
18 0.7
19 0.63
20 0.56
21 0.48
22 0.45
23 0.4
24 0.3
25 0.25
26 0.21
27 0.19
28 0.18
29 0.18
30 0.18
31 0.19
32 0.21
33 0.26
34 0.31
35 0.34
36 0.37
37 0.34
38 0.34
39 0.33
40 0.33
41 0.27
42 0.21
43 0.16
44 0.1
45 0.09
46 0.06
47 0.06
48 0.04
49 0.08
50 0.08
51 0.09
52 0.09
53 0.1
54 0.1
55 0.11
56 0.15
57 0.16
58 0.2
59 0.21
60 0.25
61 0.29
62 0.33
63 0.35
64 0.36
65 0.33
66 0.3
67 0.36
68 0.41
69 0.45
70 0.46
71 0.51
72 0.52
73 0.53
74 0.52
75 0.47
76 0.39
77 0.36
78 0.37
79 0.31
80 0.27
81 0.26
82 0.27
83 0.34
84 0.4
85 0.44
86 0.41
87 0.48
88 0.56
89 0.59
90 0.62
91 0.63
92 0.65