Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3HCY6

Protein Details
Accession A0A1E3HCY6   
Localization Confidence High
Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
226-249GSAPGQAPKSKKNKNGNGKAANNGHydrophilic
NLS Segment(s)
PositionSequence
194-211KNGKPAPTPVAGKKAKAA
229-259PGQAPKSKKNKNGNGKAANNGAAKVNRAKGK
Subcellular Location(s) nucl 22, cyto_nucl 13, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR035979  RBD_domain_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
Amino Acid Sequences MSYASYNTPYGASNSYYSAPAAPAQRPRAAPAAPAEEPHRVLFAGLPNDITANELRDLIISKPLSLPALTTTVTFLHGEDGAFFNAALVHVNSWEEAEKIREEYNGRDIDGVYILQVHHILPSYISLPLSSNVSIPSGPKAMQAPAARPQPPAGPAVQQNAKRKAGQQQQNGKAKAGQSNQPPGAALLSRISGKNGKPAPTPVAGKKAKAAAQNKSSGDNLLARLGSAPGQAPKSKKNKNGNGKAANNGAAKVNRAKGKASGMDVD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.21
3 0.2
4 0.2
5 0.18
6 0.17
7 0.18
8 0.21
9 0.24
10 0.3
11 0.34
12 0.39
13 0.39
14 0.41
15 0.43
16 0.39
17 0.37
18 0.34
19 0.36
20 0.31
21 0.32
22 0.32
23 0.3
24 0.32
25 0.29
26 0.25
27 0.18
28 0.18
29 0.18
30 0.2
31 0.19
32 0.17
33 0.17
34 0.16
35 0.17
36 0.16
37 0.16
38 0.11
39 0.11
40 0.11
41 0.11
42 0.11
43 0.11
44 0.13
45 0.11
46 0.17
47 0.15
48 0.15
49 0.16
50 0.17
51 0.17
52 0.15
53 0.15
54 0.11
55 0.13
56 0.12
57 0.12
58 0.12
59 0.11
60 0.13
61 0.12
62 0.11
63 0.1
64 0.1
65 0.1
66 0.09
67 0.1
68 0.09
69 0.09
70 0.08
71 0.07
72 0.06
73 0.06
74 0.06
75 0.05
76 0.05
77 0.05
78 0.06
79 0.06
80 0.06
81 0.07
82 0.06
83 0.07
84 0.08
85 0.09
86 0.1
87 0.11
88 0.13
89 0.14
90 0.16
91 0.21
92 0.2
93 0.2
94 0.19
95 0.18
96 0.16
97 0.15
98 0.13
99 0.06
100 0.06
101 0.06
102 0.06
103 0.06
104 0.05
105 0.05
106 0.05
107 0.05
108 0.05
109 0.06
110 0.06
111 0.06
112 0.06
113 0.06
114 0.07
115 0.07
116 0.09
117 0.08
118 0.08
119 0.07
120 0.08
121 0.08
122 0.08
123 0.09
124 0.08
125 0.08
126 0.09
127 0.1
128 0.1
129 0.15
130 0.16
131 0.17
132 0.22
133 0.26
134 0.26
135 0.26
136 0.26
137 0.22
138 0.23
139 0.22
140 0.16
141 0.15
142 0.15
143 0.2
144 0.24
145 0.29
146 0.35
147 0.4
148 0.41
149 0.39
150 0.4
151 0.45
152 0.49
153 0.51
154 0.53
155 0.57
156 0.64
157 0.71
158 0.7
159 0.61
160 0.54
161 0.48
162 0.45
163 0.38
164 0.35
165 0.32
166 0.39
167 0.38
168 0.36
169 0.34
170 0.27
171 0.25
172 0.2
173 0.15
174 0.09
175 0.1
176 0.11
177 0.11
178 0.13
179 0.17
180 0.17
181 0.25
182 0.28
183 0.3
184 0.31
185 0.34
186 0.35
187 0.36
188 0.4
189 0.35
190 0.41
191 0.4
192 0.38
193 0.38
194 0.39
195 0.39
196 0.42
197 0.44
198 0.43
199 0.46
200 0.52
201 0.5
202 0.48
203 0.44
204 0.37
205 0.33
206 0.28
207 0.23
208 0.19
209 0.18
210 0.15
211 0.15
212 0.15
213 0.13
214 0.12
215 0.12
216 0.14
217 0.18
218 0.22
219 0.26
220 0.35
221 0.44
222 0.52
223 0.6
224 0.67
225 0.73
226 0.8
227 0.87
228 0.88
229 0.87
230 0.82
231 0.78
232 0.71
233 0.66
234 0.56
235 0.47
236 0.42
237 0.34
238 0.34
239 0.35
240 0.38
241 0.38
242 0.38
243 0.4
244 0.39
245 0.44
246 0.45