Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3I547

Protein Details
Accession A0A1E3I547   
Localization Confidence Low
Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
70-100GQPMSPRGAQRKRTRKRTLPRKKKAESDAGEBasic
NLS Segment(s)
PositionSequence
73-94MSPRGAQRKRTRKRTLPRKKKA
Subcellular Location(s) mito 20.5, cyto_mito 11.5, nucl 5
Family & Domain DBs
Amino Acid Sequences MGLRGSAICCTSHGHLWRVHGTGKAGDLKRTGSPWKVFLDCCDQRRIALEDTLYNDSAVTEEKLAAKPAGQPMSPRGAQRKRTRKRTLPRKKKAESDAGESAKQIRT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.3
3 0.34
4 0.36
5 0.35
6 0.34
7 0.3
8 0.28
9 0.25
10 0.26
11 0.29
12 0.27
13 0.27
14 0.26
15 0.26
16 0.26
17 0.28
18 0.28
19 0.26
20 0.27
21 0.28
22 0.31
23 0.3
24 0.29
25 0.28
26 0.34
27 0.33
28 0.33
29 0.33
30 0.3
31 0.28
32 0.31
33 0.31
34 0.23
35 0.19
36 0.18
37 0.15
38 0.18
39 0.2
40 0.17
41 0.13
42 0.12
43 0.1
44 0.1
45 0.09
46 0.07
47 0.05
48 0.06
49 0.08
50 0.08
51 0.1
52 0.09
53 0.09
54 0.12
55 0.16
56 0.18
57 0.17
58 0.18
59 0.2
60 0.25
61 0.27
62 0.27
63 0.32
64 0.38
65 0.47
66 0.56
67 0.64
68 0.69
69 0.78
70 0.85
71 0.85
72 0.89
73 0.91
74 0.92
75 0.92
76 0.93
77 0.93
78 0.9
79 0.89
80 0.85
81 0.84
82 0.77
83 0.74
84 0.72
85 0.65
86 0.58
87 0.5