Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3HU86

Protein Details
Accession A0A1E3HU86    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
145-168RATATKKRTKRATRRLPQQHQPSYHydrophilic
NLS Segment(s)
PositionSequence
137-159KGKGKGKARATATKKRTKRATRR
Subcellular Location(s) nucl 17, cyto_nucl 15.5, cyto 8
Family & Domain DBs
Amino Acid Sequences MADITPPPSQNNTPQRTFPAPSHPQGSQKSHASGLGADEVTVPPPASALSPPGASARAEIPEDTSYTAAPSGPVPAGDSMDLDNIPSPGSGDYDELLESDPEALMEEPEAAWDGEGEGEIEVDPQEIDSDSESEEEKGKGKGKARATATKKRTKRATRRLPQQHQPSYPSRTRPDLKYESGKGGGGRKDEQYEFEIVQRWNTQFGDVLGPAPKRDIPPALANGPEPESEVTPSAPSAPSAPSAPAKPIQPAELTQPNIEPAEPTEPTEGEQITAEPSAPETAPSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.57
3 0.57
4 0.57
5 0.5
6 0.5
7 0.5
8 0.51
9 0.52
10 0.48
11 0.5
12 0.54
13 0.57
14 0.53
15 0.51
16 0.49
17 0.46
18 0.43
19 0.36
20 0.29
21 0.25
22 0.23
23 0.18
24 0.15
25 0.14
26 0.14
27 0.14
28 0.14
29 0.11
30 0.07
31 0.08
32 0.08
33 0.08
34 0.09
35 0.1
36 0.11
37 0.11
38 0.12
39 0.14
40 0.14
41 0.13
42 0.14
43 0.13
44 0.14
45 0.14
46 0.14
47 0.15
48 0.15
49 0.16
50 0.16
51 0.14
52 0.12
53 0.12
54 0.12
55 0.09
56 0.08
57 0.08
58 0.09
59 0.08
60 0.08
61 0.09
62 0.09
63 0.1
64 0.1
65 0.1
66 0.08
67 0.09
68 0.09
69 0.08
70 0.08
71 0.07
72 0.07
73 0.07
74 0.07
75 0.06
76 0.07
77 0.08
78 0.08
79 0.08
80 0.08
81 0.08
82 0.08
83 0.08
84 0.07
85 0.06
86 0.06
87 0.05
88 0.04
89 0.05
90 0.05
91 0.04
92 0.05
93 0.05
94 0.04
95 0.04
96 0.05
97 0.04
98 0.04
99 0.04
100 0.04
101 0.04
102 0.04
103 0.04
104 0.03
105 0.03
106 0.03
107 0.04
108 0.04
109 0.04
110 0.03
111 0.03
112 0.04
113 0.04
114 0.04
115 0.04
116 0.05
117 0.05
118 0.06
119 0.07
120 0.07
121 0.08
122 0.09
123 0.1
124 0.12
125 0.15
126 0.18
127 0.22
128 0.28
129 0.3
130 0.36
131 0.38
132 0.45
133 0.49
134 0.54
135 0.58
136 0.61
137 0.62
138 0.63
139 0.69
140 0.7
141 0.74
142 0.76
143 0.79
144 0.79
145 0.86
146 0.89
147 0.87
148 0.85
149 0.84
150 0.8
151 0.71
152 0.67
153 0.62
154 0.58
155 0.55
156 0.51
157 0.45
158 0.45
159 0.47
160 0.45
161 0.48
162 0.46
163 0.47
164 0.47
165 0.46
166 0.42
167 0.39
168 0.37
169 0.3
170 0.3
171 0.28
172 0.25
173 0.25
174 0.23
175 0.26
176 0.26
177 0.26
178 0.23
179 0.22
180 0.2
181 0.2
182 0.23
183 0.19
184 0.21
185 0.22
186 0.21
187 0.21
188 0.21
189 0.2
190 0.16
191 0.17
192 0.17
193 0.14
194 0.15
195 0.16
196 0.16
197 0.16
198 0.17
199 0.18
200 0.17
201 0.2
202 0.21
203 0.2
204 0.25
205 0.29
206 0.29
207 0.27
208 0.26
209 0.25
210 0.24
211 0.21
212 0.17
213 0.15
214 0.14
215 0.14
216 0.15
217 0.14
218 0.12
219 0.13
220 0.13
221 0.12
222 0.11
223 0.11
224 0.12
225 0.13
226 0.14
227 0.16
228 0.18
229 0.19
230 0.22
231 0.24
232 0.24
233 0.27
234 0.28
235 0.28
236 0.26
237 0.27
238 0.3
239 0.34
240 0.35
241 0.31
242 0.3
243 0.3
244 0.29
245 0.27
246 0.21
247 0.17
248 0.2
249 0.2
250 0.22
251 0.22
252 0.21
253 0.23
254 0.25
255 0.22
256 0.17
257 0.17
258 0.15
259 0.14
260 0.14
261 0.13
262 0.1
263 0.11
264 0.13
265 0.12