Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C1G935

Protein Details
Accession C1G935    Localization Confidence Low Confidence Score 7.4
NoLS Segment(s)
PositionSequenceProtein Nature
30-49QLYRRLLRAHRKKLPKDMRLBasic
NLS Segment(s)
Subcellular Location(s) mito 19, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR008381  SDHAF3/Sdh7  
Gene Ontology GO:0005759  C:mitochondrial matrix  
GO:0006094  P:gluconeogenesis  
GO:0034553  P:mitochondrial respiratory chain complex II assembly  
KEGG pbn:PADG_03771  -  
Pfam View protein in Pfam  
PF13233  Complex1_LYR_2  
CDD cd20270  Complex1_LYR_SDHAF3_LYRM10  
Amino Acid Sequences MRASPRLLMANPLPTLSNAGQQFALLPPLQLYRRLLRAHRKKLPKDMRLLGDEYVKSEFRAHRNIDNPIHIVGFLTEWQSYAQKLEGDTWQGEKLDKAKIDKMSDQQIGQLYELMNAIKNKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.26
3 0.22
4 0.25
5 0.2
6 0.21
7 0.2
8 0.19
9 0.2
10 0.15
11 0.17
12 0.1
13 0.1
14 0.1
15 0.14
16 0.15
17 0.17
18 0.2
19 0.21
20 0.27
21 0.3
22 0.35
23 0.42
24 0.52
25 0.59
26 0.64
27 0.71
28 0.71
29 0.78
30 0.82
31 0.76
32 0.73
33 0.69
34 0.64
35 0.57
36 0.53
37 0.43
38 0.36
39 0.3
40 0.23
41 0.2
42 0.16
43 0.14
44 0.16
45 0.18
46 0.18
47 0.24
48 0.25
49 0.27
50 0.3
51 0.35
52 0.34
53 0.32
54 0.3
55 0.25
56 0.23
57 0.18
58 0.14
59 0.09
60 0.08
61 0.07
62 0.07
63 0.06
64 0.07
65 0.08
66 0.08
67 0.09
68 0.09
69 0.1
70 0.1
71 0.1
72 0.12
73 0.13
74 0.15
75 0.15
76 0.16
77 0.17
78 0.16
79 0.16
80 0.16
81 0.17
82 0.2
83 0.22
84 0.24
85 0.28
86 0.33
87 0.37
88 0.4
89 0.43
90 0.45
91 0.45
92 0.41
93 0.39
94 0.38
95 0.34
96 0.3
97 0.27
98 0.2
99 0.18
100 0.18
101 0.15
102 0.16