Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3I6M8

Protein Details
Accession A0A1E3I6M8   
Localization Confidence Low
Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
73-96MGLAKLGRGRRRRRGRPIKAEESQBasic
NLS Segment(s)
PositionSequence
77-91KLGRGRRRRRGRPIK
Subcellular Location(s) mito 22.5, mito_nucl 13.5, nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR037151  AlkB-like_sf  
IPR032870  ALKBH7-like  
Gene Ontology GO:0005759  C:mitochondrial matrix  
GO:0006974  P:DNA damage response  
GO:1902445  P:regulation of mitochondrial membrane permeability involved in programmed necrotic cell death  
Amino Acid Sequences MSRFRTATRCITSLGSKRSLQTTTQPLPLSLHSTSPLIRPHHQPHIQCLAKDNDFAIYTDFLNVEEQEALVGMGLAKLGRGRRRRRGRPIKAEESQQVRDGIQRLFVGEYEFEEGHYDSVIHHFRESLVSTLPPSPSPTLLRALAKLYNIFPLLPSPVPPNPSESDLPPPGTLTHFLHLAPEGDIGPHVDNLEASGRVILGLSLGAERTLRLVRKKGEGEDGWDVRLPSGSVYIQR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.46
3 0.43
4 0.44
5 0.46
6 0.45
7 0.39
8 0.39
9 0.42
10 0.41
11 0.45
12 0.43
13 0.39
14 0.39
15 0.38
16 0.35
17 0.27
18 0.24
19 0.2
20 0.21
21 0.21
22 0.23
23 0.28
24 0.28
25 0.31
26 0.38
27 0.43
28 0.51
29 0.56
30 0.54
31 0.54
32 0.6
33 0.58
34 0.5
35 0.49
36 0.45
37 0.4
38 0.38
39 0.32
40 0.24
41 0.21
42 0.21
43 0.18
44 0.13
45 0.12
46 0.12
47 0.12
48 0.1
49 0.1
50 0.1
51 0.09
52 0.08
53 0.08
54 0.06
55 0.06
56 0.06
57 0.04
58 0.04
59 0.03
60 0.03
61 0.03
62 0.03
63 0.03
64 0.06
65 0.1
66 0.18
67 0.27
68 0.36
69 0.47
70 0.58
71 0.67
72 0.77
73 0.84
74 0.87
75 0.89
76 0.89
77 0.87
78 0.79
79 0.74
80 0.68
81 0.62
82 0.53
83 0.44
84 0.36
85 0.28
86 0.27
87 0.25
88 0.19
89 0.15
90 0.14
91 0.12
92 0.12
93 0.12
94 0.1
95 0.08
96 0.08
97 0.09
98 0.08
99 0.08
100 0.09
101 0.09
102 0.08
103 0.08
104 0.07
105 0.05
106 0.09
107 0.11
108 0.1
109 0.1
110 0.1
111 0.1
112 0.12
113 0.13
114 0.1
115 0.09
116 0.09
117 0.1
118 0.12
119 0.12
120 0.11
121 0.13
122 0.12
123 0.14
124 0.15
125 0.16
126 0.17
127 0.19
128 0.19
129 0.18
130 0.19
131 0.18
132 0.17
133 0.17
134 0.15
135 0.14
136 0.14
137 0.13
138 0.11
139 0.1
140 0.12
141 0.11
142 0.12
143 0.14
144 0.16
145 0.19
146 0.19
147 0.22
148 0.21
149 0.25
150 0.25
151 0.23
152 0.27
153 0.27
154 0.29
155 0.24
156 0.23
157 0.2
158 0.2
159 0.22
160 0.17
161 0.17
162 0.16
163 0.15
164 0.16
165 0.16
166 0.15
167 0.12
168 0.11
169 0.09
170 0.09
171 0.09
172 0.1
173 0.1
174 0.09
175 0.09
176 0.08
177 0.08
178 0.09
179 0.11
180 0.1
181 0.09
182 0.08
183 0.08
184 0.08
185 0.08
186 0.06
187 0.04
188 0.04
189 0.04
190 0.05
191 0.05
192 0.05
193 0.05
194 0.06
195 0.09
196 0.14
197 0.19
198 0.25
199 0.32
200 0.36
201 0.45
202 0.49
203 0.5
204 0.53
205 0.49
206 0.5
207 0.52
208 0.49
209 0.42
210 0.4
211 0.37
212 0.28
213 0.28
214 0.22
215 0.14
216 0.16