Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3HMP6

Protein Details
Accession A0A1E3HMP6   
Localization Confidence Medium
Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MAPPRPSKPTHRARRSRHPRDSSSRIEBasic
NLS Segment(s)
PositionSequence
6-19PSKPTHRARRSRHP
Subcellular Location(s) nucl 17.5, cyto_nucl 10, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR022235  DUF3760  
Pfam View protein in Pfam  
PF12586  DUF3760  
Amino Acid Sequences MAPPRPSKPTHRARRSRHPRDSSSRIELTPLDPLHPVHYIILDHLLQMVPATYIRLSKGLCTYGTARLSAPVDFDDQLVSHSHKSVRKRQDVKWLFSVTQSRTI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.91
3 0.91
4 0.91
5 0.88
6 0.86
7 0.85
8 0.84
9 0.79
10 0.75
11 0.67
12 0.56
13 0.49
14 0.42
15 0.33
16 0.32
17 0.25
18 0.19
19 0.18
20 0.18
21 0.18
22 0.18
23 0.17
24 0.11
25 0.12
26 0.11
27 0.1
28 0.12
29 0.09
30 0.08
31 0.08
32 0.07
33 0.06
34 0.06
35 0.06
36 0.04
37 0.04
38 0.04
39 0.04
40 0.05
41 0.06
42 0.08
43 0.08
44 0.09
45 0.11
46 0.12
47 0.12
48 0.14
49 0.15
50 0.19
51 0.19
52 0.19
53 0.17
54 0.18
55 0.19
56 0.17
57 0.16
58 0.11
59 0.13
60 0.12
61 0.12
62 0.1
63 0.09
64 0.1
65 0.11
66 0.13
67 0.12
68 0.14
69 0.19
70 0.24
71 0.31
72 0.4
73 0.48
74 0.57
75 0.63
76 0.66
77 0.72
78 0.75
79 0.74
80 0.72
81 0.67
82 0.57
83 0.56
84 0.57