Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3HHY5

Protein Details
Accession A0A1E3HHY5    Localization Confidence Low Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
58-81ERIRYRCGARHKARSKKCKYYGMAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10.5, cyto_nucl 8, mito 7, cyto 4.5, pero 4
Family & Domain DBs
Amino Acid Sequences MDDASLDGPATLERALRFAARAEDDEQLQHTLMRRAPIQAAPGAWRSEGPVLGQSNAERIRYRCGARHKARSKKCKYYGMAAGEEPEVPRDDTDWRDWEQASGM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.12
3 0.12
4 0.13
5 0.13
6 0.16
7 0.17
8 0.19
9 0.2
10 0.2
11 0.2
12 0.2
13 0.2
14 0.17
15 0.15
16 0.14
17 0.13
18 0.15
19 0.16
20 0.18
21 0.17
22 0.17
23 0.19
24 0.19
25 0.19
26 0.17
27 0.16
28 0.15
29 0.17
30 0.16
31 0.14
32 0.12
33 0.12
34 0.12
35 0.11
36 0.09
37 0.11
38 0.11
39 0.11
40 0.12
41 0.1
42 0.14
43 0.15
44 0.16
45 0.14
46 0.15
47 0.2
48 0.23
49 0.25
50 0.27
51 0.35
52 0.44
53 0.5
54 0.6
55 0.65
56 0.71
57 0.79
58 0.84
59 0.84
60 0.84
61 0.84
62 0.82
63 0.76
64 0.73
65 0.7
66 0.64
67 0.58
68 0.47
69 0.41
70 0.32
71 0.3
72 0.23
73 0.17
74 0.14
75 0.12
76 0.12
77 0.12
78 0.16
79 0.19
80 0.24
81 0.26
82 0.27
83 0.3
84 0.3