Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E3HTG5

Protein Details
Accession A0A1E3HTG5    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
192-211EEKRGRKRSVEEEQRWKRPGBasic
222-243RLEALSKEKRGKEKRFRSVVDGBasic
NLS Segment(s)
PositionSequence
228-236KEKRGKEKR
Subcellular Location(s) nucl 15.5, cyto_nucl 11, cyto 5.5, mito 5
Family & Domain DBs
Amino Acid Sequences MTAIQRPSTPFPYTHTLVHSTTHSYFEPTPMPYGHPLHFHLAPMPSPVPPSLLAKRRGAPISPLPTPTSAPMVRSTSRPVRPRPSRALLSQQPQPSEPIPTIGEVLSRQTSRCPSECSTSSSFSAPSPSMPITPHYPTPQLEAPTPLALPSPLCSPALSPCEPVIATPPELPGFSFRLAGSGSDCGEDEEEEEKRGRKRSVEEEQRWKRPGTPVQFQKMLERLEALSKEKRGKEKRFRSVVDGGSWVVVG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.37
3 0.36
4 0.34
5 0.35
6 0.32
7 0.3
8 0.29
9 0.29
10 0.26
11 0.26
12 0.26
13 0.27
14 0.28
15 0.24
16 0.26
17 0.23
18 0.26
19 0.27
20 0.3
21 0.29
22 0.29
23 0.3
24 0.32
25 0.32
26 0.29
27 0.27
28 0.25
29 0.24
30 0.24
31 0.22
32 0.18
33 0.19
34 0.19
35 0.17
36 0.17
37 0.22
38 0.26
39 0.32
40 0.36
41 0.38
42 0.41
43 0.45
44 0.46
45 0.41
46 0.39
47 0.4
48 0.41
49 0.39
50 0.38
51 0.34
52 0.33
53 0.33
54 0.29
55 0.26
56 0.21
57 0.21
58 0.22
59 0.25
60 0.25
61 0.26
62 0.31
63 0.33
64 0.4
65 0.45
66 0.48
67 0.55
68 0.62
69 0.67
70 0.69
71 0.67
72 0.64
73 0.6
74 0.62
75 0.57
76 0.53
77 0.52
78 0.47
79 0.41
80 0.38
81 0.37
82 0.29
83 0.25
84 0.21
85 0.17
86 0.15
87 0.14
88 0.14
89 0.11
90 0.11
91 0.09
92 0.11
93 0.11
94 0.11
95 0.11
96 0.12
97 0.16
98 0.19
99 0.2
100 0.23
101 0.23
102 0.28
103 0.29
104 0.32
105 0.31
106 0.3
107 0.29
108 0.25
109 0.24
110 0.18
111 0.19
112 0.14
113 0.11
114 0.11
115 0.11
116 0.11
117 0.11
118 0.13
119 0.14
120 0.16
121 0.18
122 0.18
123 0.2
124 0.19
125 0.23
126 0.24
127 0.22
128 0.2
129 0.2
130 0.19
131 0.18
132 0.17
133 0.13
134 0.11
135 0.09
136 0.09
137 0.08
138 0.08
139 0.09
140 0.09
141 0.09
142 0.1
143 0.14
144 0.19
145 0.18
146 0.18
147 0.17
148 0.18
149 0.18
150 0.17
151 0.17
152 0.14
153 0.15
154 0.14
155 0.15
156 0.15
157 0.15
158 0.15
159 0.13
160 0.14
161 0.13
162 0.14
163 0.12
164 0.13
165 0.13
166 0.13
167 0.12
168 0.11
169 0.11
170 0.1
171 0.11
172 0.1
173 0.1
174 0.1
175 0.1
176 0.11
177 0.11
178 0.13
179 0.15
180 0.18
181 0.22
182 0.29
183 0.3
184 0.32
185 0.38
186 0.45
187 0.54
188 0.61
189 0.65
190 0.71
191 0.77
192 0.8
193 0.77
194 0.69
195 0.63
196 0.61
197 0.61
198 0.57
199 0.59
200 0.59
201 0.63
202 0.67
203 0.63
204 0.6
205 0.57
206 0.5
207 0.41
208 0.34
209 0.28
210 0.29
211 0.31
212 0.3
213 0.31
214 0.35
215 0.42
216 0.47
217 0.56
218 0.6
219 0.68
220 0.75
221 0.79
222 0.84
223 0.85
224 0.83
225 0.79
226 0.77
227 0.7
228 0.62
229 0.54
230 0.43