Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E3I339

Protein Details
Accession A0A1E3I339    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
13-39KVRSQCPKVEPQEKKKQPKGRALKRLQHydrophilic
NLS Segment(s)
PositionSequence
25-37EKKKQPKGRALKR
Subcellular Location(s) mito 11, nucl 10.5, cyto_nucl 8.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MGKVHGSLARAGKVRSQCPKVEPQEKKKQPKGRALKRLQYTRRFVNVTVAPGGKRRMNQQPVGKSG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.44
3 0.45
4 0.44
5 0.46
6 0.54
7 0.57
8 0.61
9 0.63
10 0.64
11 0.71
12 0.77
13 0.82
14 0.82
15 0.82
16 0.79
17 0.8
18 0.82
19 0.8
20 0.82
21 0.79
22 0.77
23 0.76
24 0.78
25 0.76
26 0.73
27 0.68
28 0.63
29 0.62
30 0.56
31 0.49
32 0.47
33 0.42
34 0.36
35 0.35
36 0.3
37 0.26
38 0.27
39 0.31
40 0.27
41 0.27
42 0.31
43 0.39
44 0.45
45 0.52
46 0.58