Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3I6K9

Protein Details
Accession A0A1E3I6K9   
Localization Confidence High
Confidence Score 17.2
NoLS Segment(s)
PositionSequenceProtein Nature
401-430RIPGKRSLSGRKVRRVKKTKRETDAKGYMVBasic
NLS Segment(s)
PositionSequence
282-318AKKPADAKGIKKEAGQSSPEKKPTTKAAPRPSNSKRK
389-421SKGRGKDGEKVGRIPGKRSLSGRKVRRVKKTKR
453-469KAAPKAAPAKPKPPIKA
483-488KKGGPG
Subcellular Location(s) nucl 21, cyto_nucl 13, mito 3, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR019038  POLD3  
IPR041913  POLD3_sf  
Gene Ontology GO:0043625  C:delta DNA polymerase complex  
GO:0006260  P:DNA replication  
Pfam View protein in Pfam  
PF09507  CDC27  
Amino Acid Sequences MATAEQQKQAARKLTYWLESERRIVSYRVLSRELGLHVNVAKDILLKHLQSNPSLSSTYLLSGPLLSSSSLTQTQLSPSHGAGGGGGKGFRDLGEGMVKIVDMDERSDAGSDADADADADAAGEEGKVANGENERLGDDQDTRMDGVGNDRGAAPGDGGLGGGEVIGEDGDGDGVRRERVDRWGVVFAADDMLEEKKRLFNPGHVSVHVYSLSPAPISDPTQFIIPNTSIRSHPETQYNTEVYGTFTGDAFKPAAQPTVAAGVKKEAVQGKKEDSAAAVFGAKKPADAKGIKKEAGQSSPEKKPTTKAAPRPSNSKRKVVTSDTENDEPAPSKPAPKPSTSSSTSAAPSTTKPKAKTAEEEDLAALEAMAGMDDSDDEFSVTSFAKDASKGRGKDGEKVGRIPGKRSLSGRKVRRVKKTKRETDAKGYMVSKDYYTDESYSGESEPEQKPDIKAAPKAAPAKPKPPIKAQGSSSSTGSGSGVKKGGPGAGGKPAGQSTLMGFFKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.49
3 0.48
4 0.48
5 0.47
6 0.48
7 0.5
8 0.45
9 0.42
10 0.4
11 0.37
12 0.36
13 0.38
14 0.41
15 0.42
16 0.42
17 0.4
18 0.39
19 0.41
20 0.38
21 0.32
22 0.25
23 0.23
24 0.22
25 0.22
26 0.21
27 0.17
28 0.15
29 0.13
30 0.13
31 0.16
32 0.19
33 0.19
34 0.23
35 0.29
36 0.32
37 0.32
38 0.35
39 0.32
40 0.3
41 0.3
42 0.26
43 0.21
44 0.19
45 0.19
46 0.16
47 0.14
48 0.11
49 0.11
50 0.1
51 0.1
52 0.1
53 0.08
54 0.09
55 0.09
56 0.12
57 0.14
58 0.15
59 0.15
60 0.15
61 0.19
62 0.21
63 0.23
64 0.22
65 0.2
66 0.22
67 0.21
68 0.2
69 0.17
70 0.16
71 0.14
72 0.13
73 0.13
74 0.1
75 0.1
76 0.1
77 0.09
78 0.1
79 0.09
80 0.1
81 0.13
82 0.13
83 0.13
84 0.13
85 0.13
86 0.1
87 0.1
88 0.1
89 0.07
90 0.08
91 0.09
92 0.09
93 0.1
94 0.1
95 0.1
96 0.09
97 0.09
98 0.08
99 0.07
100 0.07
101 0.06
102 0.06
103 0.05
104 0.05
105 0.05
106 0.04
107 0.03
108 0.03
109 0.03
110 0.03
111 0.03
112 0.03
113 0.03
114 0.04
115 0.04
116 0.06
117 0.08
118 0.09
119 0.1
120 0.1
121 0.11
122 0.12
123 0.13
124 0.12
125 0.12
126 0.13
127 0.13
128 0.13
129 0.12
130 0.12
131 0.11
132 0.1
133 0.12
134 0.14
135 0.13
136 0.12
137 0.12
138 0.12
139 0.13
140 0.12
141 0.09
142 0.06
143 0.06
144 0.05
145 0.05
146 0.05
147 0.04
148 0.03
149 0.03
150 0.02
151 0.02
152 0.02
153 0.02
154 0.02
155 0.02
156 0.02
157 0.02
158 0.03
159 0.03
160 0.05
161 0.06
162 0.06
163 0.07
164 0.09
165 0.11
166 0.17
167 0.21
168 0.21
169 0.23
170 0.25
171 0.24
172 0.23
173 0.21
174 0.15
175 0.12
176 0.1
177 0.07
178 0.06
179 0.08
180 0.08
181 0.08
182 0.08
183 0.12
184 0.13
185 0.17
186 0.17
187 0.21
188 0.28
189 0.35
190 0.37
191 0.33
192 0.36
193 0.32
194 0.33
195 0.27
196 0.2
197 0.13
198 0.11
199 0.11
200 0.08
201 0.07
202 0.07
203 0.08
204 0.11
205 0.11
206 0.11
207 0.11
208 0.13
209 0.13
210 0.12
211 0.12
212 0.11
213 0.12
214 0.13
215 0.14
216 0.13
217 0.17
218 0.23
219 0.22
220 0.24
221 0.28
222 0.29
223 0.31
224 0.34
225 0.31
226 0.25
227 0.24
228 0.22
229 0.16
230 0.14
231 0.11
232 0.08
233 0.07
234 0.08
235 0.07
236 0.08
237 0.08
238 0.07
239 0.08
240 0.09
241 0.09
242 0.08
243 0.08
244 0.08
245 0.13
246 0.13
247 0.12
248 0.12
249 0.12
250 0.13
251 0.13
252 0.15
253 0.14
254 0.15
255 0.18
256 0.2
257 0.22
258 0.24
259 0.24
260 0.21
261 0.17
262 0.15
263 0.13
264 0.11
265 0.1
266 0.08
267 0.08
268 0.11
269 0.1
270 0.1
271 0.11
272 0.12
273 0.17
274 0.2
275 0.24
276 0.3
277 0.34
278 0.35
279 0.35
280 0.39
281 0.36
282 0.36
283 0.35
284 0.32
285 0.34
286 0.39
287 0.43
288 0.4
289 0.37
290 0.38
291 0.42
292 0.46
293 0.48
294 0.51
295 0.56
296 0.63
297 0.65
298 0.71
299 0.73
300 0.74
301 0.69
302 0.68
303 0.6
304 0.57
305 0.6
306 0.55
307 0.51
308 0.45
309 0.47
310 0.44
311 0.42
312 0.37
313 0.32
314 0.28
315 0.25
316 0.2
317 0.19
318 0.14
319 0.19
320 0.22
321 0.31
322 0.33
323 0.35
324 0.38
325 0.38
326 0.45
327 0.42
328 0.42
329 0.34
330 0.35
331 0.33
332 0.29
333 0.25
334 0.2
335 0.19
336 0.23
337 0.28
338 0.3
339 0.31
340 0.37
341 0.42
342 0.44
343 0.49
344 0.49
345 0.5
346 0.46
347 0.44
348 0.38
349 0.32
350 0.29
351 0.21
352 0.13
353 0.05
354 0.05
355 0.03
356 0.03
357 0.03
358 0.02
359 0.02
360 0.03
361 0.03
362 0.04
363 0.04
364 0.04
365 0.05
366 0.05
367 0.06
368 0.07
369 0.06
370 0.06
371 0.07
372 0.09
373 0.11
374 0.13
375 0.21
376 0.29
377 0.29
378 0.33
379 0.4
380 0.41
381 0.47
382 0.54
383 0.54
384 0.49
385 0.5
386 0.52
387 0.5
388 0.5
389 0.45
390 0.45
391 0.41
392 0.43
393 0.46
394 0.5
395 0.54
396 0.62
397 0.67
398 0.69
399 0.74
400 0.78
401 0.84
402 0.85
403 0.86
404 0.87
405 0.9
406 0.89
407 0.89
408 0.9
409 0.86
410 0.86
411 0.82
412 0.73
413 0.67
414 0.58
415 0.51
416 0.44
417 0.38
418 0.28
419 0.23
420 0.23
421 0.21
422 0.23
423 0.22
424 0.2
425 0.2
426 0.2
427 0.19
428 0.18
429 0.15
430 0.13
431 0.18
432 0.2
433 0.22
434 0.24
435 0.25
436 0.26
437 0.31
438 0.37
439 0.36
440 0.38
441 0.41
442 0.43
443 0.47
444 0.53
445 0.52
446 0.56
447 0.56
448 0.6
449 0.63
450 0.67
451 0.65
452 0.67
453 0.71
454 0.68
455 0.7
456 0.66
457 0.67
458 0.64
459 0.61
460 0.53
461 0.45
462 0.38
463 0.31
464 0.27
465 0.23
466 0.2
467 0.22
468 0.22
469 0.2
470 0.22
471 0.22
472 0.23
473 0.19
474 0.21
475 0.2
476 0.26
477 0.28
478 0.27
479 0.28
480 0.27
481 0.26
482 0.23
483 0.21
484 0.15
485 0.22
486 0.24