Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3HRH6

Protein Details
Accession A0A1E3HRH6   
Localization Confidence Low
Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
75-100VLRIPQRCMHRRGSRKRRSAVLFRTFHydrophilic
NLS Segment(s)
PositionSequence
89-90RK
Subcellular Location(s) mito 12, extr 5, plas 4, nucl 3, cyto 2
Family & Domain DBs
Amino Acid Sequences MRCMATLPCAGWGYCAVALALGITQHDAVTAQSGPNITHPTNHMTPYDPAPLFILSPSHLLPSPTLCQPYAAPLVLRIPQRCMHRRGSRKRRSAVLFRTFWVAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.11
4 0.09
5 0.09
6 0.08
7 0.07
8 0.04
9 0.04
10 0.05
11 0.05
12 0.05
13 0.05
14 0.05
15 0.05
16 0.07
17 0.07
18 0.07
19 0.07
20 0.08
21 0.08
22 0.11
23 0.15
24 0.13
25 0.14
26 0.16
27 0.2
28 0.21
29 0.23
30 0.21
31 0.19
32 0.2
33 0.22
34 0.25
35 0.19
36 0.18
37 0.18
38 0.17
39 0.15
40 0.13
41 0.11
42 0.07
43 0.08
44 0.08
45 0.08
46 0.08
47 0.09
48 0.09
49 0.12
50 0.13
51 0.14
52 0.16
53 0.15
54 0.15
55 0.15
56 0.18
57 0.18
58 0.16
59 0.14
60 0.13
61 0.16
62 0.19
63 0.23
64 0.21
65 0.22
66 0.27
67 0.35
68 0.41
69 0.43
70 0.49
71 0.55
72 0.65
73 0.72
74 0.79
75 0.81
76 0.84
77 0.85
78 0.84
79 0.82
80 0.82
81 0.8
82 0.78
83 0.7
84 0.62