Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3I6D8

Protein Details
Accession A0A1E3I6D8   
Localization Confidence Low
Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
58-77LGLSLKKKRKCRIVPPEWLSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, cyto_nucl 14, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR021151  GINS_A  
IPR036224  GINS_bundle-like_dom_sf  
IPR007257  GINS_Psf2  
Gene Ontology GO:0000228  C:nuclear chromosome  
GO:0006260  P:DNA replication  
Pfam View protein in Pfam  
PF05916  Sld5  
CDD cd11712  GINS_A_psf2  
cd21694  GINS_B_Psf2  
Amino Acid Sequences MALPKSLQKSLTPDELTFLAEQNHINIVPLFSMTPVRLVSGIYGPFHPPSAARVPIWLGLSLKKKRKCRIVPPEWLSVENLLQVLKNEKENSEGFERLPRRFMEISKVLLDVALDDISQATQVRSLLKDIREVRQAKIRFGLQSEDVLQSDYLQVTNLTPLELSELKPFLIRSMSLMQSLKAQNEEEEDEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.35
3 0.33
4 0.27
5 0.23
6 0.17
7 0.15
8 0.15
9 0.14
10 0.15
11 0.13
12 0.14
13 0.13
14 0.12
15 0.1
16 0.11
17 0.09
18 0.08
19 0.1
20 0.09
21 0.11
22 0.11
23 0.11
24 0.11
25 0.11
26 0.11
27 0.13
28 0.14
29 0.13
30 0.14
31 0.15
32 0.16
33 0.16
34 0.15
35 0.12
36 0.15
37 0.19
38 0.2
39 0.18
40 0.19
41 0.2
42 0.22
43 0.22
44 0.19
45 0.15
46 0.18
47 0.26
48 0.33
49 0.4
50 0.45
51 0.53
52 0.59
53 0.68
54 0.72
55 0.74
56 0.78
57 0.78
58 0.81
59 0.77
60 0.77
61 0.67
62 0.59
63 0.48
64 0.38
65 0.29
66 0.19
67 0.15
68 0.08
69 0.07
70 0.07
71 0.09
72 0.09
73 0.12
74 0.12
75 0.12
76 0.16
77 0.16
78 0.18
79 0.18
80 0.18
81 0.16
82 0.22
83 0.24
84 0.21
85 0.24
86 0.21
87 0.23
88 0.23
89 0.23
90 0.24
91 0.24
92 0.25
93 0.23
94 0.23
95 0.18
96 0.16
97 0.16
98 0.09
99 0.07
100 0.05
101 0.04
102 0.04
103 0.04
104 0.04
105 0.05
106 0.05
107 0.04
108 0.05
109 0.06
110 0.08
111 0.09
112 0.12
113 0.15
114 0.16
115 0.23
116 0.25
117 0.28
118 0.35
119 0.36
120 0.36
121 0.41
122 0.41
123 0.36
124 0.38
125 0.36
126 0.3
127 0.29
128 0.3
129 0.22
130 0.23
131 0.23
132 0.21
133 0.18
134 0.18
135 0.16
136 0.13
137 0.13
138 0.11
139 0.09
140 0.08
141 0.08
142 0.07
143 0.1
144 0.1
145 0.09
146 0.08
147 0.08
148 0.13
149 0.14
150 0.15
151 0.16
152 0.17
153 0.17
154 0.19
155 0.19
156 0.16
157 0.17
158 0.16
159 0.16
160 0.21
161 0.22
162 0.25
163 0.26
164 0.25
165 0.3
166 0.32
167 0.3
168 0.27
169 0.27
170 0.23
171 0.27