Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0A0HWU1

Protein Details
Accession A0A0A0HWU1    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
86-112ILEHSRREKARSAREKRKQLEDRLAKVBasic
NLS Segment(s)
PositionSequence
91-133RREKARSAREKRKQLEDRLAKVRAEEERQRKKFEDGNLPNKRR
Subcellular Location(s) nucl 24, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006555  ATP-dep_Helicase_C  
IPR010614  DEAD_2  
IPR045028  DinG/Rad3-like  
IPR002464  DNA/RNA_helicase_DEAH_CS  
IPR014013  Helic_SF1/SF2_ATP-bd_DinG/Rad3  
IPR006554  Helicase-like_DEXD_c2  
IPR027417  P-loop_NTPase  
IPR013020  Rad3/Chl1-like  
Gene Ontology GO:0005634  C:nucleus  
GO:0005524  F:ATP binding  
GO:0003677  F:DNA binding  
GO:0003678  F:DNA helicase activity  
GO:0016818  F:hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides  
GO:0007049  P:cell cycle  
GO:0006974  P:DNA damage response  
GO:0006139  P:nucleobase-containing compound metabolic process  
KEGG pbn:PADG_12004  -  
Pfam View protein in Pfam  
PF06733  DEAD_2  
PF13307  Helicase_C_2  
PROSITE View protein in PROSITE  
PS00690  DEAH_ATP_HELICASE  
PS51193  HELICASE_ATP_BIND_2  
CDD cd18788  SF2_C_XPD  
Amino Acid Sequences MAVAQKTSSENTFHHPFTPYDIQLQFMQALYECIEEGKVGIFESPTGTGKSLSLICGSLSWLRDHKREIFLNTVDQSLSDGEPEWILEHSRREKARSAREKRKQLEDRLAKVRAEEERQRKKFEDGNLPNKRRRLNAENDGSKQDHDESQFELEGYYSDDDERVAASSMTKSDGIFSVDTLALLEKLKGGPVDTNVDIEQENEVQVFYCSRTHSQLTQFAHELRRVNLPPSIPPEVDDDKAAADAVSNGIDSLGETLKHLSLGSRNTLCINPKVRALGNPTAINERCLEIQRPETPAEHKCSFVPNKENEVLVNDFRDHTLAKVLDIEDIGKVGSKIGVCPYYAARSIVKYSEIITLPYPLLLQRSAREALNISLKHHVVIIDEAHNLMDAISNIHSVSVSLSQLKLALYQLTTYARKYKTRLNGSNRVYVTQVIRLVNSLSEYLTRVLERNRPAEGVLRPSDIMTGKGVDQINPHKLSRYLHKSKLARKVDGFIEHSSTESQGLAESKNAQRSSTPVLFQVQSFLLSLMNPSSEGKLFFENTQNDVLMKYILLDPTNHFREIVEDARAVILAGGTMSPMEDYADHLFPYLSPERLRTYSYGHVIPSDNLTAMPVTKGAFNTEFDFTYAKRNDESLIMGLGRTIAALCRVIPDGVVVFFPSYDYLNQVLTIWKKLLPNSQLSVLDSIQKSKVLFHESQDKATNTDELLQGYSNAINAGSGGGALLLSVMGGKLSEGINFSDRLGRGVIVVGLPFPNLRSAVWQAKIQHVEHKTYEREDGQGMSEESRKLTAKAAVREFYENSCMRTVNQCIGRAIRHQNDYAAIIMMDRRYGTPRIQNKLPNWIRQNLVAAASEQPIERTIGDISAFFRKKRAVDTTTTG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.35
3 0.33
4 0.37
5 0.42
6 0.37
7 0.38
8 0.37
9 0.37
10 0.35
11 0.36
12 0.29
13 0.22
14 0.21
15 0.14
16 0.15
17 0.13
18 0.12
19 0.1
20 0.1
21 0.1
22 0.09
23 0.09
24 0.09
25 0.08
26 0.08
27 0.09
28 0.09
29 0.09
30 0.12
31 0.14
32 0.14
33 0.16
34 0.16
35 0.16
36 0.16
37 0.19
38 0.18
39 0.17
40 0.16
41 0.15
42 0.15
43 0.14
44 0.17
45 0.17
46 0.17
47 0.2
48 0.25
49 0.3
50 0.35
51 0.4
52 0.44
53 0.48
54 0.51
55 0.52
56 0.52
57 0.49
58 0.51
59 0.47
60 0.41
61 0.33
62 0.28
63 0.25
64 0.2
65 0.17
66 0.12
67 0.11
68 0.11
69 0.11
70 0.11
71 0.1
72 0.09
73 0.12
74 0.14
75 0.21
76 0.27
77 0.35
78 0.38
79 0.41
80 0.49
81 0.55
82 0.64
83 0.67
84 0.71
85 0.75
86 0.82
87 0.88
88 0.86
89 0.88
90 0.85
91 0.83
92 0.84
93 0.82
94 0.8
95 0.77
96 0.74
97 0.64
98 0.56
99 0.52
100 0.47
101 0.46
102 0.47
103 0.5
104 0.58
105 0.62
106 0.67
107 0.64
108 0.64
109 0.62
110 0.6
111 0.61
112 0.59
113 0.66
114 0.71
115 0.75
116 0.76
117 0.76
118 0.72
119 0.66
120 0.65
121 0.62
122 0.61
123 0.64
124 0.68
125 0.69
126 0.68
127 0.67
128 0.6
129 0.52
130 0.45
131 0.37
132 0.31
133 0.27
134 0.25
135 0.22
136 0.24
137 0.24
138 0.21
139 0.18
140 0.14
141 0.12
142 0.13
143 0.11
144 0.09
145 0.09
146 0.09
147 0.09
148 0.09
149 0.09
150 0.08
151 0.08
152 0.07
153 0.08
154 0.1
155 0.1
156 0.12
157 0.13
158 0.11
159 0.12
160 0.13
161 0.15
162 0.13
163 0.13
164 0.13
165 0.13
166 0.13
167 0.11
168 0.11
169 0.09
170 0.09
171 0.09
172 0.08
173 0.08
174 0.1
175 0.1
176 0.1
177 0.11
178 0.13
179 0.18
180 0.17
181 0.19
182 0.18
183 0.19
184 0.18
185 0.16
186 0.15
187 0.11
188 0.11
189 0.09
190 0.08
191 0.08
192 0.08
193 0.08
194 0.08
195 0.1
196 0.13
197 0.15
198 0.2
199 0.22
200 0.27
201 0.31
202 0.37
203 0.37
204 0.38
205 0.38
206 0.38
207 0.38
208 0.37
209 0.34
210 0.28
211 0.33
212 0.31
213 0.31
214 0.3
215 0.28
216 0.28
217 0.32
218 0.34
219 0.26
220 0.26
221 0.3
222 0.3
223 0.3
224 0.26
225 0.2
226 0.16
227 0.17
228 0.15
229 0.09
230 0.06
231 0.05
232 0.06
233 0.05
234 0.05
235 0.05
236 0.05
237 0.05
238 0.04
239 0.06
240 0.06
241 0.06
242 0.07
243 0.08
244 0.09
245 0.09
246 0.09
247 0.08
248 0.12
249 0.14
250 0.19
251 0.19
252 0.2
253 0.21
254 0.24
255 0.26
256 0.28
257 0.3
258 0.26
259 0.27
260 0.29
261 0.28
262 0.29
263 0.33
264 0.32
265 0.32
266 0.32
267 0.31
268 0.35
269 0.34
270 0.32
271 0.26
272 0.21
273 0.19
274 0.2
275 0.21
276 0.18
277 0.22
278 0.24
279 0.26
280 0.26
281 0.26
282 0.28
283 0.3
284 0.35
285 0.31
286 0.29
287 0.27
288 0.33
289 0.35
290 0.37
291 0.4
292 0.36
293 0.41
294 0.41
295 0.41
296 0.33
297 0.33
298 0.29
299 0.23
300 0.21
301 0.15
302 0.14
303 0.14
304 0.15
305 0.12
306 0.09
307 0.13
308 0.12
309 0.11
310 0.13
311 0.13
312 0.12
313 0.12
314 0.12
315 0.07
316 0.07
317 0.07
318 0.06
319 0.05
320 0.05
321 0.06
322 0.06
323 0.07
324 0.09
325 0.11
326 0.1
327 0.11
328 0.13
329 0.14
330 0.15
331 0.16
332 0.14
333 0.14
334 0.16
335 0.15
336 0.15
337 0.13
338 0.13
339 0.16
340 0.15
341 0.15
342 0.14
343 0.15
344 0.13
345 0.13
346 0.12
347 0.08
348 0.09
349 0.09
350 0.1
351 0.09
352 0.13
353 0.14
354 0.14
355 0.14
356 0.14
357 0.15
358 0.21
359 0.2
360 0.18
361 0.2
362 0.2
363 0.2
364 0.19
365 0.17
366 0.11
367 0.12
368 0.11
369 0.09
370 0.09
371 0.09
372 0.09
373 0.08
374 0.07
375 0.06
376 0.05
377 0.04
378 0.05
379 0.05
380 0.06
381 0.06
382 0.06
383 0.05
384 0.05
385 0.06
386 0.06
387 0.06
388 0.07
389 0.07
390 0.07
391 0.08
392 0.08
393 0.08
394 0.07
395 0.07
396 0.06
397 0.06
398 0.08
399 0.11
400 0.12
401 0.12
402 0.18
403 0.2
404 0.23
405 0.25
406 0.31
407 0.37
408 0.46
409 0.53
410 0.55
411 0.61
412 0.61
413 0.66
414 0.59
415 0.51
416 0.42
417 0.35
418 0.28
419 0.21
420 0.21
421 0.14
422 0.14
423 0.13
424 0.13
425 0.11
426 0.11
427 0.09
428 0.06
429 0.06
430 0.07
431 0.07
432 0.08
433 0.08
434 0.09
435 0.11
436 0.17
437 0.19
438 0.2
439 0.2
440 0.2
441 0.2
442 0.23
443 0.22
444 0.22
445 0.2
446 0.19
447 0.18
448 0.18
449 0.19
450 0.14
451 0.14
452 0.09
453 0.09
454 0.08
455 0.13
456 0.13
457 0.12
458 0.15
459 0.18
460 0.23
461 0.25
462 0.25
463 0.21
464 0.23
465 0.24
466 0.3
467 0.36
468 0.37
469 0.4
470 0.48
471 0.52
472 0.58
473 0.67
474 0.62
475 0.56
476 0.5
477 0.49
478 0.44
479 0.41
480 0.37
481 0.27
482 0.25
483 0.22
484 0.21
485 0.18
486 0.16
487 0.12
488 0.09
489 0.08
490 0.07
491 0.08
492 0.07
493 0.08
494 0.12
495 0.13
496 0.19
497 0.2
498 0.19
499 0.19
500 0.21
501 0.27
502 0.25
503 0.24
504 0.19
505 0.22
506 0.22
507 0.21
508 0.21
509 0.14
510 0.12
511 0.11
512 0.1
513 0.08
514 0.07
515 0.08
516 0.06
517 0.06
518 0.06
519 0.06
520 0.07
521 0.08
522 0.09
523 0.1
524 0.11
525 0.12
526 0.13
527 0.19
528 0.19
529 0.21
530 0.21
531 0.2
532 0.18
533 0.17
534 0.16
535 0.09
536 0.08
537 0.07
538 0.07
539 0.08
540 0.08
541 0.09
542 0.11
543 0.18
544 0.21
545 0.2
546 0.19
547 0.18
548 0.2
549 0.22
550 0.22
551 0.17
552 0.14
553 0.14
554 0.14
555 0.14
556 0.12
557 0.08
558 0.05
559 0.03
560 0.03
561 0.03
562 0.03
563 0.03
564 0.03
565 0.03
566 0.03
567 0.03
568 0.04
569 0.06
570 0.09
571 0.1
572 0.1
573 0.11
574 0.11
575 0.1
576 0.16
577 0.16
578 0.15
579 0.15
580 0.17
581 0.21
582 0.23
583 0.25
584 0.21
585 0.23
586 0.26
587 0.29
588 0.28
589 0.24
590 0.25
591 0.24
592 0.23
593 0.21
594 0.16
595 0.13
596 0.11
597 0.11
598 0.1
599 0.09
600 0.08
601 0.07
602 0.07
603 0.08
604 0.09
605 0.11
606 0.13
607 0.14
608 0.16
609 0.17
610 0.17
611 0.16
612 0.17
613 0.15
614 0.22
615 0.23
616 0.21
617 0.21
618 0.21
619 0.21
620 0.21
621 0.22
622 0.14
623 0.13
624 0.12
625 0.11
626 0.1
627 0.09
628 0.08
629 0.06
630 0.05
631 0.04
632 0.05
633 0.06
634 0.06
635 0.08
636 0.09
637 0.09
638 0.09
639 0.09
640 0.08
641 0.08
642 0.09
643 0.07
644 0.06
645 0.06
646 0.07
647 0.07
648 0.08
649 0.07
650 0.1
651 0.1
652 0.11
653 0.11
654 0.11
655 0.15
656 0.16
657 0.17
658 0.16
659 0.18
660 0.2
661 0.23
662 0.3
663 0.29
664 0.32
665 0.33
666 0.36
667 0.34
668 0.33
669 0.33
670 0.26
671 0.28
672 0.24
673 0.24
674 0.21
675 0.22
676 0.21
677 0.21
678 0.24
679 0.25
680 0.26
681 0.26
682 0.36
683 0.35
684 0.39
685 0.42
686 0.39
687 0.34
688 0.34
689 0.32
690 0.22
691 0.23
692 0.2
693 0.16
694 0.16
695 0.14
696 0.13
697 0.13
698 0.13
699 0.1
700 0.09
701 0.07
702 0.06
703 0.06
704 0.06
705 0.04
706 0.04
707 0.03
708 0.03
709 0.03
710 0.03
711 0.03
712 0.02
713 0.02
714 0.02
715 0.02
716 0.02
717 0.03
718 0.03
719 0.05
720 0.05
721 0.06
722 0.08
723 0.1
724 0.12
725 0.13
726 0.14
727 0.18
728 0.18
729 0.18
730 0.18
731 0.16
732 0.14
733 0.14
734 0.15
735 0.09
736 0.09
737 0.09
738 0.08
739 0.09
740 0.09
741 0.08
742 0.1
743 0.1
744 0.1
745 0.14
746 0.2
747 0.27
748 0.29
749 0.33
750 0.33
751 0.4
752 0.45
753 0.42
754 0.44
755 0.4
756 0.43
757 0.43
758 0.47
759 0.43
760 0.41
761 0.45
762 0.38
763 0.37
764 0.33
765 0.3
766 0.26
767 0.25
768 0.24
769 0.21
770 0.23
771 0.21
772 0.21
773 0.23
774 0.23
775 0.2
776 0.23
777 0.27
778 0.31
779 0.38
780 0.43
781 0.42
782 0.43
783 0.46
784 0.44
785 0.41
786 0.42
787 0.35
788 0.32
789 0.31
790 0.29
791 0.27
792 0.32
793 0.33
794 0.33
795 0.37
796 0.37
797 0.39
798 0.41
799 0.42
800 0.43
801 0.49
802 0.48
803 0.47
804 0.45
805 0.44
806 0.43
807 0.41
808 0.35
809 0.26
810 0.18
811 0.15
812 0.16
813 0.14
814 0.13
815 0.13
816 0.14
817 0.17
818 0.21
819 0.26
820 0.33
821 0.41
822 0.47
823 0.54
824 0.6
825 0.59
826 0.67
827 0.68
828 0.68
829 0.65
830 0.63
831 0.59
832 0.54
833 0.55
834 0.46
835 0.42
836 0.33
837 0.28
838 0.25
839 0.24
840 0.22
841 0.17
842 0.16
843 0.15
844 0.15
845 0.14
846 0.14
847 0.13
848 0.13
849 0.14
850 0.14
851 0.16
852 0.24
853 0.28
854 0.26
855 0.3
856 0.34
857 0.36
858 0.43
859 0.49
860 0.44