Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3HF97

Protein Details
Accession A0A1E3HF97   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
6-30VSLKKLFVKKDRSPKKTPGNKMGPAHydrophilic
NLS Segment(s)
PositionSequence
16-21DRSPKK
Subcellular Location(s) mito 16, cyto 10
Family & Domain DBs
Amino Acid Sequences MVAFVVSLKKLFVKKDRSPKKTPGNKMGPAQAVTYKGHKRQNSSIPGAISFLAPKDATASASSPTKPPLSGAVGAVWEIPPLPALPPFAMPKTHFERALEEVNRGRSPVTETGLEGVKPVKAPEDSSGGVQDKVAAKKGEGERKVRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.6
3 0.7
4 0.73
5 0.77
6 0.8
7 0.83
8 0.83
9 0.83
10 0.82
11 0.8
12 0.78
13 0.74
14 0.71
15 0.63
16 0.54
17 0.47
18 0.39
19 0.33
20 0.29
21 0.32
22 0.32
23 0.36
24 0.42
25 0.43
26 0.47
27 0.52
28 0.59
29 0.59
30 0.58
31 0.54
32 0.47
33 0.44
34 0.38
35 0.31
36 0.22
37 0.15
38 0.1
39 0.09
40 0.08
41 0.07
42 0.09
43 0.09
44 0.09
45 0.1
46 0.1
47 0.1
48 0.13
49 0.13
50 0.12
51 0.14
52 0.14
53 0.13
54 0.13
55 0.14
56 0.14
57 0.14
58 0.13
59 0.12
60 0.11
61 0.11
62 0.1
63 0.07
64 0.05
65 0.04
66 0.04
67 0.03
68 0.04
69 0.04
70 0.05
71 0.06
72 0.07
73 0.09
74 0.11
75 0.12
76 0.14
77 0.15
78 0.2
79 0.25
80 0.28
81 0.27
82 0.26
83 0.28
84 0.3
85 0.36
86 0.32
87 0.28
88 0.28
89 0.31
90 0.31
91 0.28
92 0.24
93 0.17
94 0.21
95 0.22
96 0.21
97 0.18
98 0.18
99 0.2
100 0.21
101 0.2
102 0.15
103 0.13
104 0.12
105 0.11
106 0.11
107 0.13
108 0.13
109 0.15
110 0.17
111 0.22
112 0.21
113 0.22
114 0.27
115 0.25
116 0.24
117 0.21
118 0.23
119 0.23
120 0.25
121 0.29
122 0.25
123 0.24
124 0.32
125 0.41
126 0.47
127 0.47