Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E3HCZ3

Protein Details
Accession A0A1E3HCZ3    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
142-190GGQERVRRSKSRRGPPAKRPEERRGEGRERGRERERGRERRFQRDRVERBasic
NLS Segment(s)
PositionSequence
145-190ERVRRSKSRRGPPAKRPEERRGEGRERGRERERGRERRFQRDRVER
Subcellular Location(s) nucl 13, cyto_nucl 11.5, cyto 8, mito 6
Family & Domain DBs
Amino Acid Sequences MEVPPVPKVPGRAKGSWNGSDRASDAEKGQAGGVKDEKAQMSVGRRLSGLAGIGARGVGVGRGSYEPVRPPPAAGRDSGYSKSAQGPKPPSKDSVPAASKTRTPHSPARSAVSAGSSTSSGKAVVGEHRSALTRENLAKISGGQERVRRSKSRRGPPAKRPEERRGEGRERGRERERGRERRFQRDRVER
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.6
3 0.61
4 0.57
5 0.5
6 0.45
7 0.41
8 0.38
9 0.34
10 0.3
11 0.23
12 0.2
13 0.22
14 0.22
15 0.21
16 0.2
17 0.18
18 0.16
19 0.19
20 0.2
21 0.17
22 0.18
23 0.2
24 0.2
25 0.18
26 0.18
27 0.18
28 0.21
29 0.26
30 0.26
31 0.24
32 0.24
33 0.23
34 0.23
35 0.2
36 0.15
37 0.1
38 0.08
39 0.07
40 0.07
41 0.06
42 0.06
43 0.05
44 0.04
45 0.03
46 0.03
47 0.03
48 0.05
49 0.05
50 0.07
51 0.08
52 0.1
53 0.12
54 0.15
55 0.2
56 0.18
57 0.19
58 0.22
59 0.26
60 0.26
61 0.24
62 0.23
63 0.21
64 0.24
65 0.24
66 0.21
67 0.16
68 0.16
69 0.21
70 0.25
71 0.25
72 0.28
73 0.35
74 0.41
75 0.45
76 0.46
77 0.43
78 0.39
79 0.41
80 0.37
81 0.37
82 0.32
83 0.3
84 0.31
85 0.29
86 0.3
87 0.28
88 0.3
89 0.25
90 0.28
91 0.33
92 0.35
93 0.39
94 0.38
95 0.39
96 0.36
97 0.34
98 0.29
99 0.23
100 0.19
101 0.13
102 0.12
103 0.09
104 0.08
105 0.08
106 0.08
107 0.07
108 0.07
109 0.07
110 0.08
111 0.12
112 0.15
113 0.14
114 0.15
115 0.15
116 0.16
117 0.16
118 0.17
119 0.15
120 0.16
121 0.17
122 0.19
123 0.19
124 0.19
125 0.18
126 0.17
127 0.19
128 0.18
129 0.21
130 0.22
131 0.26
132 0.33
133 0.4
134 0.45
135 0.49
136 0.52
137 0.59
138 0.65
139 0.71
140 0.75
141 0.78
142 0.83
143 0.85
144 0.9
145 0.9
146 0.89
147 0.87
148 0.85
149 0.85
150 0.81
151 0.78
152 0.75
153 0.73
154 0.72
155 0.73
156 0.73
157 0.69
158 0.71
159 0.7
160 0.71
161 0.68
162 0.7
163 0.73
164 0.73
165 0.75
166 0.77
167 0.77
168 0.79
169 0.83
170 0.81