Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3I9F8

Protein Details
Accession A0A1E3I9F8   
Localization Confidence Low
Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
10-41VNIPKTRRTYCKGKACKKHTPHKVTQYKKGKDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 11, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MTSSLSDNRVNIPKTRRTYCKGKACKKHTPHKVTQYKKGKDSLSAQGKRRYDRKQSGYGGQTKPVFHKKAKTTKKVVLRLECTSCKTKHQLSLKRCKHFELGGDKKQRGAAISF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.6
3 0.61
4 0.6
5 0.68
6 0.71
7 0.75
8 0.76
9 0.79
10 0.82
11 0.82
12 0.86
13 0.85
14 0.86
15 0.85
16 0.84
17 0.82
18 0.83
19 0.85
20 0.81
21 0.82
22 0.82
23 0.77
24 0.73
25 0.69
26 0.59
27 0.54
28 0.52
29 0.51
30 0.51
31 0.51
32 0.52
33 0.53
34 0.56
35 0.56
36 0.58
37 0.56
38 0.55
39 0.58
40 0.58
41 0.59
42 0.58
43 0.59
44 0.57
45 0.57
46 0.48
47 0.43
48 0.4
49 0.33
50 0.35
51 0.37
52 0.36
53 0.31
54 0.38
55 0.42
56 0.51
57 0.6
58 0.63
59 0.62
60 0.66
61 0.72
62 0.73
63 0.72
64 0.68
65 0.64
66 0.61
67 0.6
68 0.55
69 0.5
70 0.48
71 0.42
72 0.4
73 0.42
74 0.42
75 0.45
76 0.52
77 0.57
78 0.61
79 0.71
80 0.75
81 0.77
82 0.74
83 0.7
84 0.64
85 0.58
86 0.56
87 0.55
88 0.55
89 0.56
90 0.63
91 0.59
92 0.57
93 0.56
94 0.5