Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E3HFT4

Protein Details
Accession A0A1E3HFT4    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
52-72GHRVMYKPRTTRSKSRPRGSLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, nucl 10.5, cyto_nucl 8, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006591  RNAP_P/RPABC4  
IPR039747  RPABC4  
IPR029040  RPABC4/Spt4  
Gene Ontology GO:0003677  F:DNA binding  
GO:0003899  F:DNA-directed 5'-3' RNA polymerase activity  
GO:0008270  F:zinc ion binding  
GO:0006351  P:DNA-templated transcription  
Pfam View protein in Pfam  
PF03604  DNA_RNApol_7kD  
Amino Acid Sequences MSQPQSRYTQQNPNPLVDRSVKVPEVIQYICGDCGAQTAMQPSEFIRCKECGHRVMYKPRTTRSKSRPRGSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.51
3 0.48
4 0.41
5 0.36
6 0.3
7 0.31
8 0.27
9 0.24
10 0.23
11 0.21
12 0.21
13 0.2
14 0.17
15 0.14
16 0.14
17 0.13
18 0.12
19 0.1
20 0.06
21 0.06
22 0.06
23 0.05
24 0.05
25 0.06
26 0.07
27 0.07
28 0.07
29 0.07
30 0.14
31 0.16
32 0.16
33 0.18
34 0.19
35 0.22
36 0.29
37 0.34
38 0.32
39 0.35
40 0.42
41 0.47
42 0.56
43 0.62
44 0.63
45 0.64
46 0.67
47 0.72
48 0.71
49 0.75
50 0.75
51 0.78
52 0.8