Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3I261

Protein Details
Accession A0A1E3I261   
Localization Confidence Medium
Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
24-49GQCGYWYLRKGRRRREKAGTPEPPEDHydrophilic
NLS Segment(s)
PositionSequence
32-40RKGRRRREK
Subcellular Location(s) nucl 14, cyto_nucl 10.833, mito_nucl 9.833, cyto 6.5, mito 4.5
Family & Domain DBs
Amino Acid Sequences MPSHPAPPASSTGRSPPFRNWIPGQCGYWYLRKGRRRREKAGTPEPPEDNSFWVKSGGNWETDIYTPNQRRRLQNSSNKEKTVKEVLGIDPKLSSLDLLVNFFQEDDVHVQMFLPNHAGVTHETLSSIIRHWLYSHKGPTKRSRKSILKELGVIRRNLESAGGLFGSGAGYDREVQFMKDNKLCTKYIKDISDAEATAEEICPHFKDWDVILRDVRPLDATLRNQSQRNQNVMQEHLDMYVVLLEEINQQVEGRKFGVYA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.47
3 0.48
4 0.52
5 0.53
6 0.57
7 0.55
8 0.55
9 0.58
10 0.59
11 0.54
12 0.46
13 0.46
14 0.42
15 0.42
16 0.39
17 0.4
18 0.45
19 0.52
20 0.6
21 0.67
22 0.75
23 0.78
24 0.82
25 0.84
26 0.85
27 0.87
28 0.88
29 0.86
30 0.81
31 0.78
32 0.71
33 0.64
34 0.56
35 0.47
36 0.4
37 0.34
38 0.29
39 0.23
40 0.23
41 0.2
42 0.18
43 0.25
44 0.23
45 0.2
46 0.2
47 0.2
48 0.2
49 0.2
50 0.21
51 0.16
52 0.23
53 0.29
54 0.35
55 0.43
56 0.47
57 0.53
58 0.59
59 0.66
60 0.66
61 0.7
62 0.73
63 0.75
64 0.75
65 0.72
66 0.67
67 0.59
68 0.54
69 0.5
70 0.41
71 0.32
72 0.29
73 0.28
74 0.33
75 0.32
76 0.27
77 0.2
78 0.2
79 0.19
80 0.16
81 0.13
82 0.05
83 0.08
84 0.08
85 0.1
86 0.1
87 0.1
88 0.1
89 0.1
90 0.09
91 0.06
92 0.07
93 0.07
94 0.08
95 0.08
96 0.08
97 0.08
98 0.09
99 0.1
100 0.09
101 0.08
102 0.07
103 0.07
104 0.07
105 0.08
106 0.07
107 0.11
108 0.11
109 0.09
110 0.09
111 0.1
112 0.1
113 0.1
114 0.09
115 0.08
116 0.08
117 0.08
118 0.09
119 0.12
120 0.16
121 0.19
122 0.26
123 0.31
124 0.35
125 0.4
126 0.5
127 0.56
128 0.59
129 0.61
130 0.64
131 0.65
132 0.67
133 0.72
134 0.68
135 0.59
136 0.57
137 0.56
138 0.54
139 0.49
140 0.43
141 0.35
142 0.29
143 0.27
144 0.22
145 0.18
146 0.1
147 0.08
148 0.08
149 0.07
150 0.06
151 0.05
152 0.05
153 0.05
154 0.04
155 0.05
156 0.04
157 0.05
158 0.06
159 0.06
160 0.09
161 0.09
162 0.1
163 0.15
164 0.19
165 0.24
166 0.26
167 0.29
168 0.31
169 0.34
170 0.35
171 0.34
172 0.35
173 0.37
174 0.41
175 0.4
176 0.39
177 0.36
178 0.39
179 0.37
180 0.32
181 0.25
182 0.18
183 0.17
184 0.14
185 0.13
186 0.1
187 0.07
188 0.09
189 0.09
190 0.11
191 0.11
192 0.11
193 0.13
194 0.15
195 0.22
196 0.25
197 0.27
198 0.28
199 0.28
200 0.3
201 0.28
202 0.27
203 0.2
204 0.17
205 0.18
206 0.22
207 0.25
208 0.3
209 0.38
210 0.42
211 0.44
212 0.49
213 0.55
214 0.55
215 0.58
216 0.54
217 0.51
218 0.51
219 0.5
220 0.47
221 0.39
222 0.33
223 0.26
224 0.23
225 0.18
226 0.14
227 0.12
228 0.1
229 0.07
230 0.07
231 0.07
232 0.1
233 0.11
234 0.11
235 0.1
236 0.1
237 0.16
238 0.18
239 0.2
240 0.18