Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3HAD2

Protein Details
Accession A0A1E3HAD2   
Localization Confidence Low
Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
18-41KNPWRLSATRKANQRKRLRRVDDVHydrophilic
74-100TTFSKHDPKFRKSQHKVPKWTRLTLREHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23.5, mito_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGALRPTSLVSSGLLWKNPWRLSATRKANQRKRLRRVDDVISMVSESGVVTKSLVKALELPTEAEMPPKDKYTTFSKHDPKFRKSQHKVPKWTRLTLRENPKGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.21
3 0.22
4 0.25
5 0.32
6 0.32
7 0.32
8 0.3
9 0.32
10 0.38
11 0.46
12 0.51
13 0.5
14 0.58
15 0.67
16 0.71
17 0.77
18 0.81
19 0.81
20 0.82
21 0.86
22 0.83
23 0.8
24 0.76
25 0.71
26 0.65
27 0.56
28 0.46
29 0.36
30 0.29
31 0.21
32 0.16
33 0.1
34 0.06
35 0.04
36 0.04
37 0.04
38 0.04
39 0.05
40 0.06
41 0.07
42 0.07
43 0.07
44 0.09
45 0.1
46 0.13
47 0.12
48 0.12
49 0.12
50 0.14
51 0.13
52 0.14
53 0.13
54 0.13
55 0.14
56 0.15
57 0.16
58 0.15
59 0.19
60 0.24
61 0.31
62 0.33
63 0.41
64 0.49
65 0.54
66 0.64
67 0.68
68 0.66
69 0.7
70 0.75
71 0.77
72 0.75
73 0.79
74 0.8
75 0.82
76 0.87
77 0.86
78 0.87
79 0.82
80 0.82
81 0.8
82 0.78
83 0.76
84 0.75
85 0.76