Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3IAL6

Protein Details
Accession A0A1E3IAL6   
Localization Confidence Medium
Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
34-59PSRHGHDKAKREGKRRVTRQMPPLPDBasic
NLS Segment(s)
PositionSequence
40-49DKAKREGKRR
Subcellular Location(s) nucl 10, cyto_nucl 9.5, cyto 5, pero 5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR013898  Atg43  
Gene Ontology GO:0140580  F:mitochondrion autophagosome adaptor activity  
GO:0000423  P:mitophagy  
Pfam View protein in Pfam  
PF08589  ATG43  
Amino Acid Sequences MTSLDPSHNPLSQKAQAVYDPAHSSPFPDNLPQPSRHGHDKAKREGKRRVTRQMPPLPDLRFEQSYLLSIRPFLKPSPRTESGREDKKSEKPSGAAAAQSTDRDEVFHWGREVDVDWQKVAWVTIRDQLFAPLIQGAVWGWASVLLAATGVALRASLYPASHVRQGRVTGGPGGSIKSAGGGDAIAGSWWKNWVGSFFGGAETNAVI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.36
3 0.34
4 0.35
5 0.33
6 0.3
7 0.29
8 0.24
9 0.25
10 0.22
11 0.24
12 0.25
13 0.26
14 0.23
15 0.24
16 0.27
17 0.32
18 0.37
19 0.36
20 0.37
21 0.39
22 0.42
23 0.45
24 0.48
25 0.5
26 0.53
27 0.6
28 0.66
29 0.71
30 0.73
31 0.74
32 0.78
33 0.79
34 0.81
35 0.81
36 0.81
37 0.79
38 0.79
39 0.81
40 0.8
41 0.74
42 0.66
43 0.63
44 0.55
45 0.48
46 0.44
47 0.38
48 0.31
49 0.27
50 0.25
51 0.2
52 0.2
53 0.19
54 0.17
55 0.13
56 0.13
57 0.15
58 0.15
59 0.17
60 0.16
61 0.24
62 0.27
63 0.32
64 0.39
65 0.42
66 0.44
67 0.46
68 0.53
69 0.52
70 0.57
71 0.54
72 0.49
73 0.49
74 0.53
75 0.54
76 0.48
77 0.41
78 0.33
79 0.33
80 0.32
81 0.28
82 0.21
83 0.15
84 0.14
85 0.13
86 0.12
87 0.11
88 0.08
89 0.08
90 0.08
91 0.08
92 0.11
93 0.12
94 0.13
95 0.13
96 0.12
97 0.12
98 0.12
99 0.12
100 0.13
101 0.15
102 0.15
103 0.15
104 0.14
105 0.15
106 0.14
107 0.14
108 0.11
109 0.08
110 0.09
111 0.14
112 0.15
113 0.16
114 0.16
115 0.16
116 0.15
117 0.13
118 0.12
119 0.08
120 0.07
121 0.06
122 0.06
123 0.05
124 0.05
125 0.05
126 0.04
127 0.04
128 0.04
129 0.04
130 0.04
131 0.04
132 0.03
133 0.03
134 0.03
135 0.03
136 0.03
137 0.03
138 0.03
139 0.03
140 0.03
141 0.04
142 0.05
143 0.06
144 0.06
145 0.09
146 0.13
147 0.15
148 0.21
149 0.23
150 0.24
151 0.27
152 0.29
153 0.29
154 0.28
155 0.27
156 0.24
157 0.22
158 0.22
159 0.19
160 0.19
161 0.15
162 0.14
163 0.12
164 0.1
165 0.1
166 0.08
167 0.07
168 0.06
169 0.06
170 0.06
171 0.06
172 0.04
173 0.05
174 0.05
175 0.06
176 0.08
177 0.08
178 0.09
179 0.1
180 0.12
181 0.15
182 0.16
183 0.17
184 0.16
185 0.17
186 0.17
187 0.17