Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3I019

Protein Details
Accession A0A1E3I019   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
130-149HVVEKIQKRRASKKSPFERYHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23.5, cyto_mito 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR003197  QCR7  
IPR036544  QCR7_sf  
Gene Ontology GO:0005750  C:mitochondrial respiratory chain complex III  
GO:0006122  P:mitochondrial electron transport, ubiquinol to cytochrome c  
Pfam View protein in Pfam  
PF02271  UCR_14kD  
Amino Acid Sequences MPSVVKMVLGNGPLGPSFAPWIRQHSGIQKYWSRWSNLYKQAAGYRQKGYLLDDLIPEETALMQKAISRLPEKAGFDRVFRQRQGLIQSALHKELPKEKWTTAQQDERYLTPYIEQVLAEDAERAEWDHHVVEKIQKRRASKKSPFERY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.11
3 0.09
4 0.12
5 0.12
6 0.17
7 0.18
8 0.25
9 0.27
10 0.29
11 0.32
12 0.37
13 0.43
14 0.41
15 0.46
16 0.45
17 0.46
18 0.51
19 0.52
20 0.48
21 0.46
22 0.48
23 0.51
24 0.54
25 0.55
26 0.48
27 0.46
28 0.47
29 0.49
30 0.48
31 0.43
32 0.37
33 0.34
34 0.34
35 0.32
36 0.3
37 0.25
38 0.21
39 0.18
40 0.16
41 0.15
42 0.14
43 0.14
44 0.1
45 0.08
46 0.06
47 0.06
48 0.06
49 0.05
50 0.04
51 0.05
52 0.07
53 0.08
54 0.1
55 0.11
56 0.11
57 0.14
58 0.17
59 0.18
60 0.19
61 0.24
62 0.22
63 0.22
64 0.28
65 0.32
66 0.32
67 0.31
68 0.31
69 0.27
70 0.29
71 0.31
72 0.28
73 0.23
74 0.22
75 0.25
76 0.25
77 0.26
78 0.24
79 0.21
80 0.19
81 0.25
82 0.26
83 0.26
84 0.27
85 0.27
86 0.33
87 0.37
88 0.43
89 0.41
90 0.46
91 0.45
92 0.48
93 0.49
94 0.42
95 0.4
96 0.34
97 0.28
98 0.2
99 0.19
100 0.15
101 0.14
102 0.13
103 0.1
104 0.11
105 0.11
106 0.11
107 0.1
108 0.08
109 0.08
110 0.08
111 0.09
112 0.08
113 0.08
114 0.1
115 0.11
116 0.13
117 0.14
118 0.16
119 0.24
120 0.32
121 0.39
122 0.44
123 0.48
124 0.54
125 0.63
126 0.71
127 0.74
128 0.75
129 0.79