Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3HBP2

Protein Details
Accession A0A1E3HBP2    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
1-35MAKSKNHTAHNQNKKAHRNKIQRPKTNKYHSLKGVHydrophilic
NLS Segment(s)
PositionSequence
15-24KAHRNKIQRP
Subcellular Location(s) nucl 14, cyto_nucl 11, cyto 6, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNHTAHNQNKKAHRNKIQRPKTNKYHSLKGVDPKVRQLAKFGKDMDGMGTGWRWDYCGTGDGCIPSVGDGPKESAFSRRRSYAPLPRVTSSQQSYLHQTLPIPRPSLPDTIVRPGANDHCSSAETPDSPPKVPRRLSVRLRLPPKNLSV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.84
3 0.84
4 0.84
5 0.84
6 0.86
7 0.89
8 0.9
9 0.9
10 0.89
11 0.89
12 0.89
13 0.88
14 0.87
15 0.83
16 0.81
17 0.77
18 0.74
19 0.69
20 0.67
21 0.66
22 0.63
23 0.57
24 0.54
25 0.55
26 0.53
27 0.48
28 0.46
29 0.45
30 0.41
31 0.44
32 0.4
33 0.34
34 0.32
35 0.32
36 0.26
37 0.19
38 0.16
39 0.12
40 0.11
41 0.08
42 0.08
43 0.08
44 0.08
45 0.06
46 0.07
47 0.07
48 0.11
49 0.11
50 0.11
51 0.12
52 0.11
53 0.11
54 0.1
55 0.09
56 0.06
57 0.08
58 0.07
59 0.07
60 0.07
61 0.09
62 0.09
63 0.1
64 0.1
65 0.16
66 0.2
67 0.24
68 0.27
69 0.28
70 0.29
71 0.33
72 0.4
73 0.41
74 0.45
75 0.47
76 0.48
77 0.46
78 0.47
79 0.44
80 0.42
81 0.35
82 0.33
83 0.29
84 0.27
85 0.32
86 0.31
87 0.3
88 0.25
89 0.24
90 0.26
91 0.3
92 0.31
93 0.27
94 0.26
95 0.3
96 0.32
97 0.34
98 0.28
99 0.28
100 0.28
101 0.31
102 0.35
103 0.3
104 0.28
105 0.29
106 0.31
107 0.29
108 0.26
109 0.22
110 0.2
111 0.21
112 0.21
113 0.2
114 0.18
115 0.17
116 0.19
117 0.26
118 0.28
119 0.28
120 0.35
121 0.4
122 0.46
123 0.48
124 0.52
125 0.52
126 0.59
127 0.66
128 0.7
129 0.72
130 0.73
131 0.79
132 0.79
133 0.76