Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E3I7P3

Protein Details
Accession A0A1E3I7P3    Localization Confidence High Confidence Score 19.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MPRSPSPPRLPHRPRTYRDDSPPYPHydrophilic
170-190RSPAIRRRTRSPPPFRRVERDBasic
NLS Segment(s)
PositionSequence
165-229HSPPIRSPAIRRRTRSPPPFRRVERDSWRDRDREVRERDWDRDRFFRRRSPSPYSPPVRRRRSPS
246-247KR
254-259DRRRSR
Subcellular Location(s) nucl 18.5, cyto_nucl 11, mito 6
Family & Domain DBs
Amino Acid Sequences MPRSPSPPRLPHRPRTYRDDSPPYPPRDDYRFAREPRYRNTNYDRNERPDWRDRERDDDRDWDYQRPRYPAGRTSWFSRDRERDERMTARSPLPRRPVAPPMDRERERERGRDERATSMAAEGSAKARSEGTPEEGQITSPVHPPPAPPVLPPISSMAGLPARPHSPPIRSPAIRRRTRSPPPFRRVERDSWRDRDREVRERDWDRDRFFRRRSPSPYSPPVRRRRSPSVSSASTPSRSSRLSPLKRALSPVSDRRRSRSPSENRSRFEPPHSPSPPPRSELHTPSPPPATAPEVSAPAPAPAPARPVPIAVPLSGFNQFAKRPPPTGPRSMGGAAAPGFAPPTGPRALAHLYGGRPPPTGPRAYAPLSTASLASAGRATAMISTPVSATPPREEIEPPRASRAPSETPSAHSTSTKDAPPSGPRLSWSERKTLPAQTPTPGPAPGLTLAPVAAVARATASPYAVSPSVNVNTVRTPYNQPASSSPTSVAATAYPVSAEQEDVKPQVEEPVLSEDQLAEMRAKEEEARVLAELPPVAVPFGGAQWEIDLANHHHHYTSLLQNTLRTHSIQRHAAMALADAEAERAAAVERRRICEGQLMAGMVGVGGMFGAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.82
3 0.83
4 0.81
5 0.82
6 0.81
7 0.74
8 0.73
9 0.76
10 0.73
11 0.69
12 0.63
13 0.6
14 0.57
15 0.61
16 0.56
17 0.57
18 0.6
19 0.58
20 0.65
21 0.66
22 0.66
23 0.68
24 0.72
25 0.68
26 0.67
27 0.73
28 0.71
29 0.7
30 0.73
31 0.72
32 0.69
33 0.73
34 0.71
35 0.7
36 0.71
37 0.72
38 0.7
39 0.72
40 0.68
41 0.7
42 0.71
43 0.69
44 0.63
45 0.63
46 0.6
47 0.59
48 0.58
49 0.57
50 0.56
51 0.57
52 0.59
53 0.57
54 0.57
55 0.55
56 0.58
57 0.56
58 0.57
59 0.58
60 0.55
61 0.56
62 0.6
63 0.6
64 0.58
65 0.61
66 0.62
67 0.61
68 0.66
69 0.66
70 0.62
71 0.62
72 0.65
73 0.61
74 0.58
75 0.54
76 0.52
77 0.54
78 0.54
79 0.55
80 0.57
81 0.57
82 0.54
83 0.56
84 0.59
85 0.58
86 0.61
87 0.6
88 0.61
89 0.66
90 0.65
91 0.64
92 0.62
93 0.64
94 0.61
95 0.61
96 0.59
97 0.58
98 0.62
99 0.65
100 0.61
101 0.55
102 0.53
103 0.47
104 0.4
105 0.32
106 0.26
107 0.18
108 0.16
109 0.12
110 0.11
111 0.12
112 0.11
113 0.11
114 0.12
115 0.12
116 0.15
117 0.17
118 0.21
119 0.21
120 0.21
121 0.24
122 0.22
123 0.22
124 0.2
125 0.19
126 0.16
127 0.17
128 0.18
129 0.17
130 0.17
131 0.18
132 0.21
133 0.26
134 0.25
135 0.22
136 0.28
137 0.29
138 0.29
139 0.29
140 0.27
141 0.21
142 0.21
143 0.2
144 0.17
145 0.16
146 0.15
147 0.15
148 0.15
149 0.16
150 0.16
151 0.2
152 0.21
153 0.24
154 0.28
155 0.33
156 0.39
157 0.4
158 0.48
159 0.54
160 0.6
161 0.62
162 0.63
163 0.64
164 0.65
165 0.73
166 0.76
167 0.77
168 0.77
169 0.77
170 0.82
171 0.8
172 0.78
173 0.74
174 0.73
175 0.71
176 0.69
177 0.7
178 0.68
179 0.68
180 0.62
181 0.58
182 0.58
183 0.55
184 0.56
185 0.55
186 0.52
187 0.55
188 0.58
189 0.62
190 0.61
191 0.59
192 0.53
193 0.56
194 0.58
195 0.58
196 0.59
197 0.61
198 0.59
199 0.62
200 0.66
201 0.66
202 0.68
203 0.67
204 0.72
205 0.71
206 0.73
207 0.74
208 0.77
209 0.77
210 0.74
211 0.74
212 0.75
213 0.76
214 0.71
215 0.69
216 0.66
217 0.6
218 0.56
219 0.52
220 0.45
221 0.39
222 0.35
223 0.29
224 0.25
225 0.23
226 0.23
227 0.28
228 0.36
229 0.39
230 0.44
231 0.49
232 0.51
233 0.51
234 0.52
235 0.45
236 0.39
237 0.4
238 0.43
239 0.45
240 0.48
241 0.48
242 0.5
243 0.56
244 0.55
245 0.55
246 0.56
247 0.57
248 0.6
249 0.7
250 0.72
251 0.66
252 0.67
253 0.67
254 0.58
255 0.55
256 0.51
257 0.44
258 0.47
259 0.47
260 0.46
261 0.47
262 0.53
263 0.49
264 0.45
265 0.43
266 0.39
267 0.41
268 0.43
269 0.43
270 0.41
271 0.4
272 0.4
273 0.39
274 0.33
275 0.28
276 0.24
277 0.21
278 0.15
279 0.15
280 0.14
281 0.14
282 0.14
283 0.14
284 0.13
285 0.1
286 0.09
287 0.09
288 0.09
289 0.07
290 0.11
291 0.12
292 0.13
293 0.13
294 0.14
295 0.13
296 0.16
297 0.16
298 0.12
299 0.12
300 0.11
301 0.12
302 0.13
303 0.13
304 0.1
305 0.12
306 0.12
307 0.14
308 0.18
309 0.18
310 0.19
311 0.23
312 0.31
313 0.33
314 0.39
315 0.38
316 0.35
317 0.36
318 0.35
319 0.31
320 0.22
321 0.19
322 0.13
323 0.11
324 0.1
325 0.06
326 0.06
327 0.05
328 0.06
329 0.05
330 0.08
331 0.08
332 0.09
333 0.09
334 0.12
335 0.14
336 0.14
337 0.15
338 0.15
339 0.14
340 0.18
341 0.2
342 0.18
343 0.16
344 0.16
345 0.2
346 0.21
347 0.22
348 0.19
349 0.2
350 0.23
351 0.25
352 0.25
353 0.21
354 0.19
355 0.19
356 0.18
357 0.16
358 0.11
359 0.1
360 0.09
361 0.08
362 0.06
363 0.05
364 0.05
365 0.05
366 0.05
367 0.05
368 0.05
369 0.06
370 0.06
371 0.06
372 0.06
373 0.07
374 0.08
375 0.09
376 0.1
377 0.11
378 0.13
379 0.14
380 0.15
381 0.17
382 0.2
383 0.28
384 0.32
385 0.31
386 0.34
387 0.35
388 0.34
389 0.34
390 0.35
391 0.32
392 0.29
393 0.33
394 0.29
395 0.31
396 0.34
397 0.33
398 0.28
399 0.24
400 0.24
401 0.24
402 0.26
403 0.25
404 0.22
405 0.22
406 0.24
407 0.27
408 0.31
409 0.29
410 0.26
411 0.26
412 0.3
413 0.34
414 0.39
415 0.38
416 0.39
417 0.38
418 0.42
419 0.44
420 0.44
421 0.44
422 0.43
423 0.43
424 0.38
425 0.38
426 0.37
427 0.35
428 0.29
429 0.24
430 0.17
431 0.17
432 0.16
433 0.14
434 0.12
435 0.1
436 0.09
437 0.08
438 0.08
439 0.06
440 0.05
441 0.05
442 0.04
443 0.05
444 0.05
445 0.06
446 0.06
447 0.07
448 0.07
449 0.07
450 0.1
451 0.1
452 0.1
453 0.1
454 0.14
455 0.15
456 0.18
457 0.18
458 0.17
459 0.19
460 0.21
461 0.22
462 0.21
463 0.25
464 0.28
465 0.35
466 0.35
467 0.35
468 0.36
469 0.42
470 0.4
471 0.36
472 0.31
473 0.27
474 0.26
475 0.24
476 0.21
477 0.13
478 0.13
479 0.12
480 0.11
481 0.09
482 0.08
483 0.1
484 0.09
485 0.1
486 0.11
487 0.13
488 0.16
489 0.17
490 0.18
491 0.16
492 0.16
493 0.2
494 0.18
495 0.16
496 0.15
497 0.21
498 0.2
499 0.2
500 0.2
501 0.15
502 0.16
503 0.16
504 0.15
505 0.09
506 0.09
507 0.1
508 0.1
509 0.12
510 0.12
511 0.13
512 0.15
513 0.15
514 0.16
515 0.16
516 0.17
517 0.17
518 0.17
519 0.15
520 0.13
521 0.12
522 0.11
523 0.1
524 0.09
525 0.08
526 0.07
527 0.07
528 0.08
529 0.08
530 0.07
531 0.08
532 0.09
533 0.09
534 0.08
535 0.11
536 0.12
537 0.19
538 0.21
539 0.21
540 0.2
541 0.21
542 0.23
543 0.26
544 0.31
545 0.28
546 0.3
547 0.31
548 0.34
549 0.36
550 0.38
551 0.34
552 0.29
553 0.3
554 0.35
555 0.42
556 0.44
557 0.43
558 0.41
559 0.39
560 0.39
561 0.33
562 0.27
563 0.2
564 0.14
565 0.13
566 0.1
567 0.1
568 0.08
569 0.07
570 0.06
571 0.05
572 0.06
573 0.11
574 0.14
575 0.21
576 0.26
577 0.31
578 0.36
579 0.37
580 0.37
581 0.41
582 0.4
583 0.37
584 0.34
585 0.31
586 0.25
587 0.24
588 0.22
589 0.13
590 0.12
591 0.06
592 0.04