Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3HU64

Protein Details
Accession A0A1E3HU64    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
84-128MGTFYQPSQRKRKNKHGFLARLKGGKNARKMLVRRLKKGRKFLSHHydrophilic
NLS Segment(s)
PositionSequence
93-125RKRKNKHGFLARLKGGKNARKMLVRRLKKGRKF
Subcellular Location(s) mito 21.5, mito_nucl 13.5, nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MPRLPRTVLPFAPRVLPQTPALAFRAPLSLPPTPLTKSPFYTHLPSRQPLTLSLLRSPLLPLPITTTNTSPLSGALGALRNVQMGTFYQPSQRKRKNKHGFLARLKGGKNARKMLVRRLKKGRKFLSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.3
3 0.29
4 0.25
5 0.27
6 0.26
7 0.25
8 0.26
9 0.22
10 0.21
11 0.19
12 0.2
13 0.15
14 0.17
15 0.19
16 0.18
17 0.19
18 0.2
19 0.22
20 0.21
21 0.25
22 0.26
23 0.25
24 0.27
25 0.27
26 0.3
27 0.31
28 0.35
29 0.36
30 0.4
31 0.41
32 0.39
33 0.4
34 0.37
35 0.34
36 0.3
37 0.32
38 0.27
39 0.25
40 0.24
41 0.23
42 0.21
43 0.2
44 0.2
45 0.15
46 0.12
47 0.1
48 0.09
49 0.12
50 0.14
51 0.16
52 0.16
53 0.16
54 0.17
55 0.18
56 0.18
57 0.14
58 0.11
59 0.1
60 0.09
61 0.09
62 0.07
63 0.07
64 0.07
65 0.08
66 0.08
67 0.07
68 0.07
69 0.07
70 0.07
71 0.06
72 0.1
73 0.11
74 0.12
75 0.19
76 0.25
77 0.32
78 0.42
79 0.51
80 0.58
81 0.64
82 0.76
83 0.8
84 0.82
85 0.86
86 0.85
87 0.86
88 0.85
89 0.85
90 0.78
91 0.72
92 0.64
93 0.61
94 0.6
95 0.56
96 0.55
97 0.53
98 0.53
99 0.56
100 0.59
101 0.63
102 0.65
103 0.67
104 0.69
105 0.74
106 0.79
107 0.79
108 0.87