Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3IKY5

Protein Details
Accession A0A1E3IKY5    Localization Confidence High Confidence Score 17.2
NoLS Segment(s)
PositionSequenceProtein Nature
235-254EELEERRKRRREDQIKINLSBasic
NLS Segment(s)
PositionSequence
151-156EKGKPK
220-226RRKKDKG
240-244RRKRR
Subcellular Location(s) nucl 18.5, cyto_nucl 12, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR022226  DUF3752  
IPR046331  GPAM1-like  
Pfam View protein in Pfam  
PF12572  DUF3752  
Amino Acid Sequences MTIGPSLPPHLSHLAQASGSRSPSGSPHSEPLTGPSSAITNVECVVGDDRPSVDKEQDEDKDDYAPALPPHMASARQTKVAGPSLPPNLISGRSSSIGPLIARPHPEDDDSDDDVYGPVPAPNIGDEDSNAYDPVKEFMELEERRRKDIEEKGKPKVTKREEWMLVPPTSGPLSSVDPLRKRPTTFSRSNAEPLEVDHSVWTETPAEKAQRIADEVAGIRRKKDKGGERLISEEEELEERRKRRREDQIKINLSQYDRGASLLDTHQGSLKSKKRTDDGAPPIWDHARDMGFTGRLLSDQERGKMIRDAKGLGDRFGHGKKGAYQM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.25
3 0.26
4 0.24
5 0.23
6 0.24
7 0.22
8 0.19
9 0.18
10 0.21
11 0.25
12 0.27
13 0.27
14 0.31
15 0.34
16 0.35
17 0.35
18 0.35
19 0.33
20 0.28
21 0.24
22 0.2
23 0.18
24 0.16
25 0.17
26 0.13
27 0.1
28 0.1
29 0.11
30 0.1
31 0.1
32 0.12
33 0.11
34 0.12
35 0.12
36 0.13
37 0.15
38 0.17
39 0.18
40 0.18
41 0.19
42 0.21
43 0.27
44 0.29
45 0.32
46 0.31
47 0.3
48 0.29
49 0.27
50 0.25
51 0.19
52 0.19
53 0.14
54 0.14
55 0.14
56 0.12
57 0.14
58 0.15
59 0.15
60 0.16
61 0.24
62 0.24
63 0.26
64 0.27
65 0.26
66 0.28
67 0.31
68 0.3
69 0.24
70 0.27
71 0.28
72 0.28
73 0.27
74 0.24
75 0.21
76 0.21
77 0.19
78 0.16
79 0.15
80 0.15
81 0.15
82 0.14
83 0.13
84 0.14
85 0.13
86 0.14
87 0.15
88 0.16
89 0.19
90 0.2
91 0.22
92 0.21
93 0.22
94 0.21
95 0.22
96 0.25
97 0.25
98 0.23
99 0.2
100 0.19
101 0.18
102 0.16
103 0.12
104 0.07
105 0.05
106 0.05
107 0.05
108 0.05
109 0.06
110 0.07
111 0.07
112 0.07
113 0.07
114 0.1
115 0.11
116 0.11
117 0.11
118 0.09
119 0.09
120 0.09
121 0.1
122 0.08
123 0.07
124 0.07
125 0.08
126 0.17
127 0.17
128 0.23
129 0.3
130 0.31
131 0.32
132 0.33
133 0.33
134 0.31
135 0.39
136 0.43
137 0.46
138 0.5
139 0.54
140 0.59
141 0.6
142 0.59
143 0.6
144 0.55
145 0.51
146 0.5
147 0.52
148 0.48
149 0.48
150 0.47
151 0.41
152 0.35
153 0.29
154 0.24
155 0.17
156 0.16
157 0.14
158 0.1
159 0.08
160 0.09
161 0.1
162 0.13
163 0.17
164 0.19
165 0.23
166 0.28
167 0.29
168 0.28
169 0.34
170 0.4
171 0.43
172 0.46
173 0.47
174 0.46
175 0.45
176 0.48
177 0.42
178 0.35
179 0.27
180 0.23
181 0.22
182 0.18
183 0.15
184 0.12
185 0.12
186 0.11
187 0.11
188 0.11
189 0.08
190 0.08
191 0.1
192 0.13
193 0.14
194 0.14
195 0.16
196 0.16
197 0.16
198 0.18
199 0.16
200 0.14
201 0.13
202 0.14
203 0.18
204 0.22
205 0.21
206 0.22
207 0.27
208 0.28
209 0.31
210 0.39
211 0.42
212 0.46
213 0.56
214 0.58
215 0.54
216 0.56
217 0.53
218 0.46
219 0.37
220 0.27
221 0.18
222 0.15
223 0.15
224 0.16
225 0.2
226 0.23
227 0.31
228 0.39
229 0.43
230 0.51
231 0.61
232 0.67
233 0.72
234 0.79
235 0.81
236 0.79
237 0.76
238 0.69
239 0.62
240 0.52
241 0.46
242 0.36
243 0.27
244 0.21
245 0.2
246 0.18
247 0.14
248 0.15
249 0.13
250 0.16
251 0.14
252 0.14
253 0.17
254 0.18
255 0.21
256 0.28
257 0.34
258 0.4
259 0.43
260 0.48
261 0.49
262 0.54
263 0.57
264 0.58
265 0.59
266 0.58
267 0.56
268 0.52
269 0.51
270 0.47
271 0.41
272 0.32
273 0.28
274 0.22
275 0.2
276 0.21
277 0.21
278 0.2
279 0.19
280 0.19
281 0.15
282 0.14
283 0.17
284 0.17
285 0.2
286 0.23
287 0.25
288 0.28
289 0.29
290 0.31
291 0.35
292 0.37
293 0.37
294 0.36
295 0.36
296 0.37
297 0.44
298 0.43
299 0.38
300 0.36
301 0.31
302 0.35
303 0.36
304 0.36
305 0.29
306 0.31