Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3IHB1

Protein Details
Accession A0A1E3IHB1   
Localization Confidence Low
Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
4-35GRTKERWRRVIVFRNEKKSGSRDRPRNNWSCEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, mito_nucl 12, mito 9.5, cyto 3
Family & Domain DBs
Amino Acid Sequences MTLGRTKERWRRVIVFRNEKKSGSRDRPRNNWSCEMVRDSRRSDLSKAVGTVATRVEVVTSTRIVWTRMLKEKNGGNNRGGERRPYVEGLDEGLQRGRCVANVYARLRDAGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.79
3 0.78
4 0.8
5 0.76
6 0.7
7 0.65
8 0.62
9 0.61
10 0.61
11 0.63
12 0.64
13 0.7
14 0.78
15 0.82
16 0.83
17 0.78
18 0.73
19 0.68
20 0.61
21 0.55
22 0.51
23 0.48
24 0.45
25 0.43
26 0.4
27 0.39
28 0.4
29 0.39
30 0.35
31 0.34
32 0.31
33 0.28
34 0.26
35 0.23
36 0.2
37 0.17
38 0.16
39 0.12
40 0.09
41 0.08
42 0.07
43 0.06
44 0.05
45 0.06
46 0.07
47 0.07
48 0.07
49 0.08
50 0.09
51 0.1
52 0.13
53 0.16
54 0.2
55 0.27
56 0.3
57 0.29
58 0.33
59 0.36
60 0.43
61 0.47
62 0.44
63 0.39
64 0.42
65 0.45
66 0.47
67 0.44
68 0.38
69 0.34
70 0.35
71 0.36
72 0.31
73 0.28
74 0.24
75 0.24
76 0.23
77 0.22
78 0.2
79 0.18
80 0.2
81 0.2
82 0.17
83 0.18
84 0.16
85 0.14
86 0.17
87 0.2
88 0.24
89 0.32
90 0.36
91 0.38
92 0.39