Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E3ITL1

Protein Details
Accession A0A1E3ITL1    Localization Confidence High Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MEEKRRRVLERQKEKQKIGEBasic
NLS Segment(s)
PositionSequence
4-33KRRRVLERQKEKQKIGEGKGRTLGEKKRRE
Subcellular Location(s) nucl 19, cyto 5, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR028160  Slx9-like  
Gene Ontology GO:0030686  C:90S preribosome  
GO:0005730  C:nucleolus  
GO:0030688  C:preribosome, small subunit precursor  
GO:0000462  P:maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
Pfam View protein in Pfam  
PF15341  SLX9  
Amino Acid Sequences MEEKRRRVLERQKEKQKIGEGKGRTLGEKKRREIIQEGAKRIPAVMQHPAFQQNPWATIREHAGNTLAQKTVNPKKQL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.78
3 0.77
4 0.74
5 0.69
6 0.66
7 0.58
8 0.52
9 0.55
10 0.49
11 0.42
12 0.4
13 0.43
14 0.44
15 0.49
16 0.49
17 0.5
18 0.51
19 0.52
20 0.5
21 0.49
22 0.49
23 0.46
24 0.47
25 0.4
26 0.39
27 0.35
28 0.31
29 0.25
30 0.17
31 0.14
32 0.18
33 0.18
34 0.19
35 0.21
36 0.25
37 0.24
38 0.23
39 0.26
40 0.2
41 0.22
42 0.22
43 0.22
44 0.19
45 0.2
46 0.24
47 0.22
48 0.22
49 0.2
50 0.2
51 0.2
52 0.22
53 0.23
54 0.2
55 0.16
56 0.18
57 0.26
58 0.35