Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3IZK2

Protein Details
Accession A0A1E3IZK2    Localization Confidence Low Confidence Score 5.6
NoLS Segment(s)
PositionSequenceProtein Nature
143-162LAYRKRMHFIREKKERNFEMHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 9, plas 8, E.R. 4, golg 3, nucl 1.5, cyto_nucl 1.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR045176  Got1  
Gene Ontology GO:0005829  C:cytosol  
GO:0016020  C:membrane  
GO:0006888  P:endoplasmic reticulum to Golgi vesicle-mediated transport  
GO:0042147  P:retrograde transport, endosome to Golgi  
Amino Acid Sequences MVVIPCAATDDLPVDPLPFRLTINNWSNENILFLFKAGKVERHTLLLWWDTTTLNDTTGSKLMMSRFLVFFKHPIIGIIIEFIGFVGLFGSFFPVILQALRQTPFIGHILSLPYIRGLVSDKVQFEQWQLTKADRRSEACKVLAYRKRMHFIREKKERNFEMLRFLAGTNMAM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.12
4 0.13
5 0.12
6 0.13
7 0.15
8 0.18
9 0.25
10 0.32
11 0.35
12 0.34
13 0.35
14 0.35
15 0.32
16 0.31
17 0.22
18 0.17
19 0.13
20 0.12
21 0.12
22 0.11
23 0.16
24 0.16
25 0.2
26 0.22
27 0.27
28 0.27
29 0.28
30 0.28
31 0.24
32 0.26
33 0.23
34 0.2
35 0.16
36 0.16
37 0.13
38 0.13
39 0.15
40 0.12
41 0.11
42 0.12
43 0.11
44 0.12
45 0.13
46 0.13
47 0.1
48 0.11
49 0.11
50 0.14
51 0.15
52 0.14
53 0.14
54 0.15
55 0.16
56 0.15
57 0.16
58 0.13
59 0.13
60 0.11
61 0.1
62 0.1
63 0.09
64 0.09
65 0.08
66 0.06
67 0.05
68 0.05
69 0.04
70 0.03
71 0.03
72 0.03
73 0.02
74 0.02
75 0.02
76 0.02
77 0.04
78 0.04
79 0.04
80 0.04
81 0.04
82 0.05
83 0.05
84 0.05
85 0.05
86 0.08
87 0.09
88 0.09
89 0.09
90 0.09
91 0.11
92 0.12
93 0.11
94 0.08
95 0.08
96 0.09
97 0.1
98 0.1
99 0.08
100 0.07
101 0.07
102 0.07
103 0.07
104 0.08
105 0.09
106 0.12
107 0.15
108 0.16
109 0.17
110 0.18
111 0.18
112 0.17
113 0.22
114 0.2
115 0.21
116 0.21
117 0.25
118 0.31
119 0.33
120 0.38
121 0.36
122 0.39
123 0.41
124 0.46
125 0.46
126 0.41
127 0.43
128 0.4
129 0.46
130 0.48
131 0.49
132 0.51
133 0.53
134 0.59
135 0.57
136 0.6
137 0.61
138 0.64
139 0.69
140 0.72
141 0.75
142 0.75
143 0.82
144 0.78
145 0.75
146 0.72
147 0.63
148 0.61
149 0.53
150 0.46
151 0.38
152 0.35
153 0.29